DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frc and YER039C-A

DIOPT Version :10

Sequence 1:NP_524126.1 Gene:frc / 39943 FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_010957.1 Gene:YER039C-A / 856762 SGDID:S000007226 Length:72 Species:Saccharomyces cerevisiae


Alignment Length:43 Identity:14/43 - (32%)
Similarity:24/43 - (55%) Gaps:1/43 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SALFYGLSSFMITVVNKTVLTSYHF-PSFLFLSLGQLTASIVV 107
            |.|.|..||.::||.||.|:...:| .:|:.|.:..|..::.:
Yeast    19 SILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVTL 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frcNP_524126.1 TPT 67..348 CDD:474852 13/42 (31%)
YER039C-ANP_010957.1 VRG4 10..>72 CDD:227402 14/43 (33%)

Return to query results.
Submit another query.