DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frc and HVG1

DIOPT Version :9

Sequence 1:NP_001137962.1 Gene:frc / 39943 FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_010956.1 Gene:HVG1 / 856761 SGDID:S000000841 Length:249 Species:Saccharomyces cerevisiae


Alignment Length:227 Identity:46/227 - (20%)
Similarity:104/227 - (45%) Gaps:38/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYAMIGGALLA-------------ASDDL 202
            |::|::...:..:|::....|:...|.:.::....|...|:..:::|             :.:||
Yeast    12 LAVPIYTIFKNLTIILIAYGEVLFFGGKVTSMELTSFIMMVLSSVVATWGDQQAIAIKASSLEDL 76

  Fly   203 SFNM---------RGYIYVMITNALTASNGVYV-KKKLDTSEIGKYGLMYYNSLFMFLPALAL-- 255
            ...:         .||:: |.||.::::..|.: :|::..:....|..|:||:: :.||.|.:  
Yeast    77 DQELVESTIFVLNPGYLW-MFTNCISSALFVLIMRKRIRLTNFKDYDTMFYNNV-LALPLLLVFS 139

  Fly   256 ----NYVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCLKNIC 316
                ::.|.||...|:.:.      :...::|.:|...:||.:..|.:..|:.|.::||.|..:.
Yeast   140 FIMEDWSTKNLSVNLSADS------LAAMVISGLMSVGISYCSGWCVRVTSSTTYSMVGALNKLP 198

  Fly   317 VTYLGMFIGGDYVFSWLNCIGINISVLASLLY 348
            :...|: :..|...::|:...|.:..|:.|||
Yeast   199 IALAGL-VFFDAPKNFLSFFSIFLGFLSGLLY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 44/225 (20%)
HVG1NP_010956.1 VRG4 <1..232 CDD:227402 46/227 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5070
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I1783
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R503
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.