DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frc and Tmem241

DIOPT Version :9

Sequence 1:NP_001137962.1 Gene:frc / 39943 FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_001057715.3 Gene:Tmem241 / 680558 RGDID:1590602 Length:297 Species:Rattus norvegicus


Alignment Length:267 Identity:62/267 - (23%)
Similarity:108/267 - (40%) Gaps:44/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VVNKTVLT--SYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNFPPLQRNTFAKIFPLPLIFLGNM 141
            :.||.||:  .:.:|: ||.....|...: :|.|..:|..|......|:......|..::|:|.:
  Rat    21 LTNKYVLSVLKFTYPT-LFQGWQTLIGGL-LLHMSWKLGWVEINSSLRSDVLTWLPASVLFVGII 83

  Fly   142 MFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYAMIGGALLAASDDLSFNM 206
            ..|......|::|:|..|...:.::|...:..:...:.|.:...|...::..|:.....|..|:.
  Rat    84 YAGSKALSRLAVPVFLILHNAAEVLTCGFQKCVWKEKTSLSKICSALFLLAAAVCLPFQDSQFDP 148

  Fly   207 RGYIYVMITNALTASNGVYVKKKLDT--SEIGKYGLMYYNSLF-MFLPALALNYVTGNLDQALNF 268
            .||.:.:|......|..:..:.:..|  |:|.:   .|.|.:| |.|.|.| ::.||:|.:|::|
  Rat   149 DGYFWALIHFFCVGSYKILRRSRKPTVLSDIDQ---QYLNYIFSMVLLAFA-SHPTGDLFRAMDF 209

  Fly   269 EQWNDSVFVVQFLLSC----VMGFILSYSTI---------LCTQ----------------FNSAL 304
                ..::...|..||    |:||.|..||:         .|..                |:..|
  Rat   210 ----PFLYFYSFYGSCCASGVLGFFLMLSTVKLRNILAPGQCAAWIFFAKVVTAGLSLLLFDMTL 270

  Fly   305 TTTIVGC 311
            |...|||
  Rat   271 TRATVGC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 62/267 (23%)
Tmem241XP_001057715.3 VRG4 11..>193 CDD:227402 38/176 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.