DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frc and slc35e4

DIOPT Version :9

Sequence 1:NP_001137962.1 Gene:frc / 39943 FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001017857.1 Gene:slc35e4 / 550555 ZFINID:ZDB-GENE-050417-407 Length:387 Species:Danio rerio


Alignment Length:358 Identity:84/358 - (23%)
Similarity:139/358 - (38%) Gaps:57/358 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GGSADRSSLLDGSGSK-----ELSHREREDSALFVKKIGSALFYGLSSFMIT-----VVNKTVLT 86
            |.||.|....| ||.|     |:.|                |.:.:|.:::|     .:||.:..
Zfish     6 GRSAKREETRD-SGKKSRRAPEMLH----------------LMFAVSVWLVTGTTISSLNKWIFA 53

  Fly    87 SYHFPSFLFLS-LGQLTASIVVLGMGK----RLKLVNFPPLQRNTFAKIFPLPLIFLGNMMFGLG 146
            .|:|...|.|| |..|||.:|..|:.|    |.|.|....|..:...|:|.|.|.|..::.||..
Zfish    54 VYNFRYPLLLSALHMLTAIVVDYGLIKSRVVRHKGVGEQDLTTSAKCKVFLLSLTFCASIAFGNV 118

  Fly   147 GTKTLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYAMIGGALLAASDDLSFNMRGYIY 211
            |...:.|.....:...:.|.|:.:...|||.:.......::..:..||..:...::.|:..|.::
Zfish   119 GLNYVQLSFAQMIYTTTPLFTLAISALILGKQHHFLKYTAMMPICLGASFSIMGEVQFDQTGCLF 183

  Fly   212 VMITNALTASNGVYVKKKLDTSEIGKYGLMYYNSLFMFLPALALNYVTGNLDQALNFEQWNDSVF 276
            |.....|.....:.....|...:|....|:|    .|.:|:..:..|.     ||..|.|.....
Zfish   184 VFAATMLRGVKTIQQSILLQEEKINSVFLLY----LMSIPSFCILAVA-----ALALENWAALQS 239

  Fly   277 VVQF--------LLSCVMGFILSYSTILCTQFNSALTTTIVGCLKNICVTYLGMFIGGDYVFSWL 333
            ..|:        ||||:...:.:.::.......||:|..|:|.|..:....|...:.| :..:.|
Zfish   240 PFQYDHHLWGFILLSCLGSVLYNLASCCVITLTSAVTLHILGNLNVVGNLLLSQVLFG-HELTAL 303

  Fly   334 NCIGINISVLASLLY-------TYVTFRRKRAP 359
            :|.|..:::...::|       .|:..||.|.|
Zfish   304 SCAGAALTLSGMIIYQNSEIIVAYLDARRARTP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 68/298 (23%)
slc35e4NP_001017857.1 TPT 28..318 CDD:281186 69/315 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.