DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frc and nac

DIOPT Version :9

Sequence 1:NP_001137962.1 Gene:frc / 39943 FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_649782.1 Gene:nac / 40981 FlyBaseID:FBgn0265351 Length:337 Species:Drosophila melanogaster


Alignment Length:329 Identity:88/329 - (26%)
Similarity:138/329 - (41%) Gaps:40/329 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HREREDSALFVKKIGSALF----YGLSSFMITVVNKTVLTS--YHFPSFLFLSLGQLTASIVVLG 109
            ::..|:....|.|.....|    |..:|.:...|||.:|:|  .:..:.||:|..|...|.|:..
  Fly     2 YKNLEEHNRLVNKYLKIFFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICF 66

  Fly   110 MGKRL-----KLVNFP---PLQRNTFAKIFPLPLIFLGNMMFGLGGTKTLSLPMFAAL-----RR 161
            :..||     .:..||   ||..:||.||.||.:::  .:|.   |...|||......     |.
  Fly    67 VASRLSRKYPSVFTFPEGNPLDIDTFRKILPLSVLY--TLMI---GANNLSLSYVTVAFYYIGRS 126

  Fly   162 FSILMTMLLELKILGLRPSNAVQVSVYAMIGGALLAASDDL---SFNMRGYIYVMITNALTASNG 223
            .:.:.:::|...||..|.|....:...|::.|..|....:.   .|:.||.|:.::::...|...
  Fly   127 LTTVFSVVLTYVILRQRTSFKCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSLALAMFS 191

  Fly   224 VYVKKKLDTSEIGKYGLMYYNSLF---MFLPALALNYVTGNLDQALNFEQWNDSVFVVQFLLSCV 285
            :..||.|.......:.|.|||:|:   :|||.:.:|   |.|:..:.:.....|.|.....||.:
  Fly   192 IQTKKSLGYVNQEVWLLSYYNNLYSTLLFLPLIIIN---GELESIITYPHLWASWFWAAMTLSGL 253

  Fly   286 MGFILSYSTILCTQFNSALTTTIVGCLKNICVTYLGMFIGGDY--VFSWLNCIGINISVL-ASLL 347
            .||.:.:.|.|..:..||||..|.|..|....|.:......|.  ...|.:    |:.|| ||..
  Fly   254 CGFAIGFVTALEIKVTSALTHNISGTAKACAQTVIATQYYHDVRSALWWTS----NVVVLVASAA 314

  Fly   348 YTYV 351
            ||.|
  Fly   315 YTRV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 82/308 (27%)
nacNP_649782.1 TPT 16..281 CDD:281186 73/272 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11132
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.