DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frc and SLC35E4

DIOPT Version :9

Sequence 1:NP_001137962.1 Gene:frc / 39943 FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001001479.1 Gene:SLC35E4 / 339665 HGNCID:17058 Length:350 Species:Homo sapiens


Alignment Length:293 Identity:69/293 - (23%)
Similarity:117/293 - (39%) Gaps:29/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNFPPLQRNTFAKI 130
            :||.:.|:...::.:||.:.|.:.|...|.||...:..:.:....|.|      .|:...|..::
Human    52 AALVWLLAGASMSSLNKWIFTVHGFGRPLLLSALHMLVAALACHRGAR------RPMPGGTRCRV 110

  Fly   131 FPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYAMIGGAL 195
            ..|.|.|..:|..|..|.:.:.|.:...:...:.|.|:.|...:|| |..:.:|:   |.:|...
Human   111 LLLSLTFGTSMACGNVGLRAVPLDLAQLVTTTTPLFTLALSALLLG-RRHHPLQL---AAMGPLC 171

  Fly   196 LAASDDLSFNMR----GYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYYNSL--FMFLPALA 254
            |.|:..|:...|    |..:::....|.....|.....|....:....|:|..||  |..|...|
Human   172 LGAACSLAGEFRTPPTGCGFLLAATCLRGLKSVQQSALLQEERLDAVTLLYATSLPSFCLLAGAA 236

  Fly   255 LNYVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCLKNICVTY 319
            |....|.......    .||......||||::..:.:.::.......||||..::|.|     |.
Human   237 LVLEAGVAPPPTA----GDSRLWACILLSCLLSVLYNLASFSLLALTSALTVHVLGNL-----TV 292

  Fly   320 LGMFIGGDYVF----SWLNCIGINISVLASLLY 348
            :|..|....:|    |.|:.:||.:::....||
Human   293 VGNLILSRLLFGSRLSALSYVGIALTLSGMFLY 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 67/290 (23%)
SLC35E4NP_001001479.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..42
EamA 51..178 CDD:304911 32/135 (24%)
TPT 54..325 CDD:281186 66/289 (23%)
EamA 188..324 CDD:279264 33/144 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.