DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frc and Slc35d3

DIOPT Version :9

Sequence 1:NP_001137962.1 Gene:frc / 39943 FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001100992.1 Gene:Slc35d3 / 308717 RGDID:1309428 Length:420 Species:Rattus norvegicus


Alignment Length:322 Identity:95/322 - (29%)
Similarity:155/322 - (48%) Gaps:26/322 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IGSALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQ-LTASIVVLGMG--KRLKLVNFPP---- 121
            |..|:.:|:.|..:.::.|.:::.|.|.   ||:|.| ||:|...|.:.  :||.|:..||    
  Rat    12 ISVAIAHGVFSGSLNILLKFLISRYQFS---FLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLS 73

  Fly   122 LQRNTFAKIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKIL-GLRPSNAVQV 185
            |.| :||.:..|..:.....::.|.|   |||||:...:|...|:|||:.:.:| ...||..|..
  Rat    74 LAR-SFAGVAVLSTLQSSLTLWSLRG---LSLPMYVVFKRCLPLVTMLIGVLVLKNGAPSPGVLA 134

  Fly   186 SVYAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYYNSLFMFL 250
            :|.....||.||.:.||:.:..||:..::...:.|:..|.::|....:|.|.....|..:: ...
  Rat   135 AVLITTCGAALAGAGDLTGDPIGYVTGVLAVLVHAAYLVLIQKASADTEHGPLTAQYVIAV-SAT 198

  Fly   251 PALAL-NYVTGNLDQALNFEQWND----SVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVG 310
            |.|.: ::.:.:...|..|..|.|    |:||...|:.|.|.|    :|:.||..|||:||:.||
  Rat   199 PLLVICSFASTDSIHAWTFPGWKDPAMVSIFVACILIGCAMNF----TTLHCTYINSAVTTSFVG 259

  Fly   311 CLKNICVTYLGMFIGGDYVFSWLNCIGINISVLASLLYTYVTFRRKRAPDKQDHLPS-TRGE 371
            .:|:|....:||....|...:.|...|:.::.|.|::|....|...|.....:.|.| ..||
  Rat   260 VVKSIATITVGMVAFSDVEPTSLFIAGVVVNTLGSIIYCVAKFLETRRQSNYEDLESQAEGE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 87/293 (30%)
Slc35d3NP_001100992.1 VRG4 30..308 CDD:227402 87/289 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55087
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.