DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frc and Slc35e4

DIOPT Version :9

Sequence 1:NP_001137962.1 Gene:frc / 39943 FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_695228.2 Gene:Slc35e4 / 266687 RGDID:708484 Length:350 Species:Rattus norvegicus


Alignment Length:289 Identity:69/289 - (23%)
Similarity:119/289 - (41%) Gaps:21/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNFPPLQRNTFAKI 130
            :||.:.|:...::.:||.:.|.:.|...|.||...:.|:.|....|.:      .|:..:...::
  Rat    52 AALVWLLAGASMSSLNKWIFTVHGFGRPLLLSALHMLAAAVACHWGAQ------RPVPHSIHRRV 110

  Fly   131 FPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYAMIGGAL 195
            ..|.|.|..:|..|..|..|:.|.:.......:.|.|:.|...:|| |..:.:|   :|.:|...
  Rat   111 LLLSLTFGTSMACGNVGLSTVPLDLAQLATTTTPLFTLALSALLLG-RRHHPLQ---FAAMGPLC 171

  Fly   196 LAASDDLSFNMR----GYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYYNSL--FMFLPALA 254
            |.|:..|:..:|    |..::::...|.....|.....|....:....|:|..||  |..|...|
  Rat   172 LGAACSLAGELRAPPAGCGFLLVATCLRGFKSVQQSALLQEERLDAVTLLYATSLPSFCLLAGAA 236

  Fly   255 LNYVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCLKNICVTY 319
            |....|    |.......||......||||.:..:.:.::.......||||..::|.|..:....
  Rat   237 LVLEAG----AAPPLPPTDSRLWACVLLSCFLSVVYNLASFSLLALTSALTVHVLGNLTVVGNLI 297

  Fly   320 LGMFIGGDYVFSWLNCIGINISVLASLLY 348
            |...:.|.:: |.|:.:||.:::....||
  Rat   298 LSRLLFGSHL-SALSYVGIALTLSGMFLY 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 67/286 (23%)
Slc35e4NP_695228.2 EamA 53..178 CDD:304911 33/134 (25%)
TPT 54..325 CDD:281186 66/285 (23%)
EamA 188..324 CDD:279264 32/140 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.