DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment frc and slc35e4

DIOPT Version :9

Sequence 1:NP_001137962.1 Gene:frc / 39943 FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_002931765.2 Gene:slc35e4 / 100493370 XenbaseID:XB-GENE-980438 Length:357 Species:Xenopus tropicalis


Alignment Length:330 Identity:73/330 - (22%)
Similarity:137/330 - (41%) Gaps:33/330 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 REDSALFVKKIGSALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVN 118
            :|..|..:..|.|.|.:.::...|:.:||.:...|:|...|.||...:..:|::.....|..|:|
 Frog    34 KEKRAPIIYIIASVLLWLVTGTTISSLNKWIFAVYNFKYPLLLSSFHMLTAILLDYPLIRFGLLN 98

  Fly   119 FP-----PLQRNTFAKIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLR 178
            ..     .|..|...|:|.|.|.|..::.||..|...:.|.....:...:.:.|:.|....||.|
 Frog    99 LKAEEEVALNANARFKVFLLSLTFCSSIAFGNLGLSCVQLSFAQMIYTTTPIFTLFLSKVFLGTR 163

  Fly   179 PSNAVQVSVYAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYY 243
            .:.....::..:..||..:...::.|:..|..|:..:..|.....:.....|...:|....|:|.
 Frog   164 HNTLKYTAMVPICLGACFSIIGEVQFDQTGCFYLFASTFLRGLKSIQQSSLLKEEKIHSVKLLYL 228

  Fly   244 NSL----FMFLPALALN-----YVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQ 299
            .|:    .:||.|:.|.     .|..:.|..|    |   :|:   ||||:...:.:.::.....
 Frog   229 MSIPSFCILFLAAIVLESEVVWEVPPDCDNRL----W---LFI---LLSCMGSVLYNLASFCVIT 283

  Fly   300 FNSALTTTIVGCLKNICVTYLGMFIGGDYVFSWLNCIGINISVLASLLY--------TYVTFRRK 356
            |.||:|..::|.|..:....|...:.|.:: :.|:.|||.:::....:|        .:...:|:
 Frog   284 FTSAVTIHVLGNLNIVGNLVLSRVLFGSHL-TVLSYIGIGLTLAGMFMYHNCDLISEHFAYGKRR 347

  Fly   357 RAPDK 361
            ||.::
 Frog   348 RATER 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 65/294 (22%)
slc35e4XP_002931765.2 TPT 48..331 CDD:331565 65/293 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.