DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec3 and Exoc1l

DIOPT Version :9

Sequence 1:NP_648976.2 Gene:Sec3 / 39940 FlyBaseID:FBgn0266669 Length:889 Species:Drosophila melanogaster
Sequence 2:XP_003751401.1 Gene:Exoc1l / 686911 RGDID:1591303 Length:172 Species:Rattus norvegicus


Alignment Length:118 Identity:30/118 - (25%)
Similarity:57/118 - (48%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IKHTLQKELFLASGERLLSVVTV-VKKKDKKPCYLCVVTTAPPVPVVTLCLIKQSEQREG---EY 70
            :|..|:|.||....:.|...:.: |..:|:  .||||..|  ....|.:.::|  ..|.|   :|
  Rat     5 VKEDLEKRLFKPLAQNLCEFIEIEVSVQDR--YYLCVSVT--KTDEVKISMVK--HYRVGLDEKY 63

  Fly    71 KRKRSWQLDEIKWVDGRNEQFETHEFDLQLEKLYKWYALNPHERQNFLAVLNR 123
            :..:.|.|::::.:||:....:...|||..:|:|...|.:...:.:|...::|
  Rat    64 EVTKRWSLNDLRMIDGKEADTDNPFFDLHFKKVYSLEAYSCASKYSFARTVSR 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec3NP_648976.2 PH-EXOC1 9..126 CDD:270202 30/118 (25%)
Sec3_C 200..866 CDD:286804
Exoc1lXP_003751401.1 PH-like 2..119 CDD:418428 30/118 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334920
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2148
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D201698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.