DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec3 and EXOC1L

DIOPT Version :9

Sequence 1:NP_648976.2 Gene:Sec3 / 39940 FlyBaseID:FBgn0266669 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_001338503.1 Gene:EXOC1L / 644145 HGNCID:53433 Length:172 Species:Homo sapiens


Alignment Length:119 Identity:31/119 - (26%)
Similarity:58/119 - (48%) Gaps:12/119 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IKHTLQKELFLASGERLLSVVTV-VKKKDKKPCYLCV-VTTAPPVPVVTLCLIKQSEQREG---E 69
            :|..|:|:||....:.|...:.: ...:|:  .|||| ||....|.:|   ::|  ..|.|   :
Human     5 VKEDLEKKLFKPLSQNLYEFIEIEFSVQDR--YYLCVSVTKKEEVKIV---MVK--HYRIGLDEK 62

  Fly    70 YKRKRSWQLDEIKWVDGRNEQFETHEFDLQLEKLYKWYALNPHERQNFLAVLNR 123
            |:..:.|.|::::.:||:....:...|||..:|:|...|.:...:..|...:|:
Human    63 YEVTKKWSLNDLQMIDGKEADTDNPFFDLHFKKVYSLEAYSCASKYAFARTVNK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec3NP_648976.2 PH-EXOC1 9..126 CDD:270202 31/119 (26%)
Sec3_C 200..866 CDD:286804
EXOC1LNP_001338503.1 PH-EXOC1_like 2..119 CDD:270201 31/119 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141254
Domainoid 1 1.000 59 1.000 Domainoid score I10681
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D201698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.