DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec3 and stxbp6

DIOPT Version :9

Sequence 1:NP_648976.2 Gene:Sec3 / 39940 FlyBaseID:FBgn0266669 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_001002063.1 Gene:stxbp6 / 415153 ZFINID:ZDB-GENE-040625-31 Length:211 Species:Danio rerio


Alignment Length:210 Identity:52/210 - (24%)
Similarity:85/210 - (40%) Gaps:42/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KHTLQKELFLASGERLLSVVTVVKKKDKK------------PCYLCVVTTAPPVPVVTLCLIKQS 63
            |..|.|.:||.:.||:|:.|.|.::..||            ..::|:..|......|.|..:||.
Zfish     4 KSALNKAVFLPNDERMLAAVQVKRRTKKKIPFLATGGQGEYTTFICLSVTNKKPAQVFLTKVKQF 68

  Fly    64 EQREGEYKRKRSWQLDEIKWVDGRNEQFETHEFDLQLEK-LYKWYALNPHERQNFLAVLNRQIQK 127
            | ....:.|:..|.:.:::.|:|.:...:..||||..:. ..:|.|.:..|:..|:.:|:...|:
Zfish    69 E-GSSSFIRRSQWNISQLRQVNGVDAIKDCPEFDLVFDSGSDQWTAGSAGEKCVFVQILHHTCQR 132

  Fly   128 SVRGQRAEFRNVPAAWLSEKSP-------------EKVA---------LGRAVQKTQHMDDEEDE 170
            .:..::.||.|.|...|...|.             :|.:         ||||.:||      .|.
Zfish   133 FIPERKVEFVNCPPKLLGGNSSLLHGAADSVSSAVQKASQALNERGERLGRAEEKT------SDM 191

  Fly   171 EEEAQEFTALTDKEA 185
            ...||.|.....|.|
Zfish   192 MNSAQHFADTAHKLA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec3NP_648976.2 PH-EXOC1 9..126 CDD:270202 32/127 (25%)
Sec3_C 200..866 CDD:286804
stxbp6NP_001002063.1 PH-STXBP6 2..131 CDD:270200 32/127 (25%)
SNARE 149..211 CDD:304603 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D201698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.