DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec3 and Stxbp6

DIOPT Version :9

Sequence 1:NP_648976.2 Gene:Sec3 / 39940 FlyBaseID:FBgn0266669 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_001178801.1 Gene:Stxbp6 / 362734 RGDID:1306117 Length:210 Species:Rattus norvegicus


Alignment Length:212 Identity:55/212 - (25%)
Similarity:92/212 - (43%) Gaps:47/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KHTLQKELFLASGERLLSVVTVVKKKDKK-P-----------CYLCV-VTTAPPVPVVTLCLIKQ 62
            |..:.||:|....||:|..|.|.::..|| |           .|:|: ||...|    |...|.:
  Rat     4 KSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKP----TQASITK 64

  Fly    63 SEQREG--EYKRKRSWQLDEIKWVDGRNEQFETHEFDLQLEKLY-KWYALNPHERQNFLAVLNRQ 124
            .:|.||  .:.|:..|.|::::.|:|.:...::.||||..|..: :|.|....|:..|..:|:..
  Rat    65 VKQFEGSTSFVRRSQWMLEQLRQVNGIDPNRDSAEFDLLFENAFDQWVASTASEKCTFFQILHHT 129

  Fly   125 IQKSVRGQRAEFRNVPAAWLS----------------EKSPEKV-----ALGRAVQKTQHMDDEE 168
            .|:.:..::.||.|..:..:.                :|:.:.:     .||||.:||      |
  Rat   130 CQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKT------E 188

  Fly   169 DEEEEAQEFTALTDKEA 185
            |.:..||:|.....|.|
  Rat   189 DMKNSAQQFAETAHKLA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec3NP_648976.2 PH-EXOC1 9..126 CDD:270202 37/130 (28%)
Sec3_C 200..866 CDD:286804
Stxbp6NP_001178801.1 PH-STXBP6 2..131 CDD:270200 37/130 (28%)
R-SNARE_STXBP6 149..210 CDD:277245 14/63 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334918
Domainoid 1 1.000 41 1.000 Domainoid score I12202
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D201698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.