DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec3 and STXBP6

DIOPT Version :9

Sequence 1:NP_648976.2 Gene:Sec3 / 39940 FlyBaseID:FBgn0266669 Length:889 Species:Drosophila melanogaster
Sequence 2:XP_016876721.1 Gene:STXBP6 / 29091 HGNCID:19666 Length:222 Species:Homo sapiens


Alignment Length:212 Identity:55/212 - (25%)
Similarity:92/212 - (43%) Gaps:47/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KHTLQKELFLASGERLLSVVTVVKKKDKK-P-----------CYLCV-VTTAPPVPVVTLCLIKQ 62
            |..:.||:|....||:|..|.|.::..|| |           .|:|: ||...|    |...|.:
Human    16 KSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKP----TQASITK 76

  Fly    63 SEQREG--EYKRKRSWQLDEIKWVDGRNEQFETHEFDLQLEKLY-KWYALNPHERQNFLAVLNRQ 124
            .:|.||  .:.|:..|.|::::.|:|.:...::.||||..|..: :|.|....|:..|..:|:..
Human    77 VKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHT 141

  Fly   125 IQKSVRGQRAEFRNVPAAWLS----------------EKSPEKV-----ALGRAVQKTQHMDDEE 168
            .|:.:..::.||.|..:..:.                :|:.:.:     .||||.:||      |
Human   142 CQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKT------E 200

  Fly   169 DEEEEAQEFTALTDKEA 185
            |.:..||:|.....|.|
Human   201 DLKNSAQQFAETAHKLA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec3NP_648976.2 PH-EXOC1 9..126 CDD:270202 37/130 (28%)
Sec3_C 200..866 CDD:286804
STXBP6XP_016876721.1 PH-STXBP6 14..143 CDD:270200 37/130 (28%)
R-SNARE_STXBP6 161..222 CDD:277245 14/63 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D201698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.