DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec3 and SPAC17G8.12

DIOPT Version :9

Sequence 1:NP_648976.2 Gene:Sec3 / 39940 FlyBaseID:FBgn0266669 Length:889 Species:Drosophila melanogaster
Sequence 2:NP_593735.1 Gene:SPAC17G8.12 / 2542129 PomBaseID:SPAC17G8.12 Length:608 Species:Schizosaccharomyces pombe


Alignment Length:472 Identity:91/472 - (19%)
Similarity:169/472 - (35%) Gaps:142/472 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NRQIQK--SVRGQRAEFRNVPAAWLSEKSPE-------KVALGRAVQKTQHMDDEEDEEEEAQEF 177
            :|..:|  ||..:|....|.|::.:|..:|.       :::...|:.:|.  .|.:|:    ..|
pombe   225 SRSAKKKLSVEKERRFSDNKPSSNVSRGTPSSAHSDVIEISSSSAIARTS--GDRKDD----VLF 283

  Fly   178 TALTDKEANELGKLFSECDFAIKDAEQFIEQLSRELHDLDGANMQSVLASEQKVLKMMEHIDNAI 242
            ...|.:..|:..::|.:     :.|:.|..:.|          ::.....||     ....::..
pombe   284 DTSTQRRDNQTREMFIQ-----EQAQLFPSKPS----------LRKTTRREQ-----APSFNSGT 328

  Fly   243 SEADKFENRLD-SYEDILGHVKETMEKI-GGKNAMIEIANNNNIKLMKELN-----KVISQLDLP 300
            |.:::.:|.:. |||      |.|...: .||..|    :..::||...|.     ...|::|..
pombe   329 SSSERGKNSISGSYE------KNTALALEAGKYNM----SQKDVKLSSSLESNTFASDFSKVDRD 383

  Fly   301 HSQ---QQALDEPDLKTANGRKAAIAAAQCLQQAMNSDIDPALLRLEAVQDQRKRFEKWKQKFSA 362
            .:|   ..:|:.|.:.|::.:.::.:.......:......||:.:|......|      :....|
pombe   384 ATQAALSSSLETPSVLTSSYKPSSSSKVSAKSVSRKPTGAPAIPKLPPKHPSR------QPTVRA 442

  Fly   363 TVSRFMNNLFIHLGNEIGDMQVTSTELTLPN-HSNVHRELTPYTELMHW------TKAMDRKTYD 420
            |.|                   |..::..|| ..::..||.|..|.:.:      :|...:||..
pombe   443 TPS-------------------TGKQIEPPNDEPSIGNELLPLFESLRFENRKTTSKPKAKKTLV 488

  Fly   421 GLM--RVYTASLSKIYDRDVRNFFNLAKIQVTEKLRNSREDLDMSTSSRKSAVSTIPYGTLGINR 483
            ..:  :.:.||:.|:||                  .||:.:|........|.:||:         
pombe   489 TSIPTKPHQASVEKVYD------------------LNSKINLKNIPEQSISRLSTL--------- 526

  Fly   484 DQWGPGVETADRMR-----FD-ALLEKV--LAELEPIALQE--------QLFC------INFFQM 526
             :|..|....|.::     || |::..|  ||| |.|.||.        .|.|      ||.|.:
pombe   527 -KWNEGTTIKDVLKQTEFSFDGAIISSVENLAE-EEIELQNIKSQLQDCALGCESINSTINLFSL 589

  Fly   527 DVISPTTKNTQTTLEME 543
            ::  .|..|....:|.:
pombe   590 EL--STALNGVINIEQQ 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec3NP_648976.2 PH-EXOC1 9..126 CDD:270202 1/3 (33%)
Sec3_C 200..866 CDD:286804 74/385 (19%)
SPAC17G8.12NP_593735.1 Sec3-PIP2_bind 52..131 CDD:291926
Sec3_C_2 520..605 CDD:259411 25/98 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.