DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec3 and exoc1l

DIOPT Version :9

Sequence 1:NP_648976.2 Gene:Sec3 / 39940 FlyBaseID:FBgn0266669 Length:889 Species:Drosophila melanogaster
Sequence 2:XP_017951007.1 Gene:exoc1l / 100486416 XenbaseID:XB-GENE-6462405 Length:171 Species:Xenopus tropicalis


Alignment Length:95 Identity:23/95 - (24%)
Similarity:48/95 - (50%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IKHTLQKELFLASGERLLSVVTVVKKKDKKPCYLCVVTTAPPVPVVTLCLIKQSEQ-REGEYKRK 73
            :|..::|:||...|..|...:. .|.:.|:..|||  |:......|.:.|:|.... .:.:|:..
 Frog     5 VKEDMEKKLFKPKGHTLYEFIE-TKSQLKERFYLC--TSVAKRKEVHISLVKHYRVCLDEKYEIA 66

  Fly    74 RSWQLDEIKWVDGRNEQFETHEFDLQLEKL 103
            ..|.|.:::::||::...:...||::.|::
 Frog    67 EIWLLKDLEYIDGKDADTDNSHFDMKFEEI 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec3NP_648976.2 PH-EXOC1 9..126 CDD:270202 23/95 (24%)
Sec3_C 200..866 CDD:286804
exoc1lXP_017951007.1 PH-EXOC1_like 2..119 CDD:270201 23/95 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11166
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D201698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.