DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec3 and stxbp6l

DIOPT Version :9

Sequence 1:NP_648976.2 Gene:Sec3 / 39940 FlyBaseID:FBgn0266669 Length:889 Species:Drosophila melanogaster
Sequence 2:XP_005160460.1 Gene:stxbp6l / 100002110 ZFINID:ZDB-GENE-040724-16 Length:279 Species:Danio rerio


Alignment Length:290 Identity:62/290 - (21%)
Similarity:123/290 - (42%) Gaps:75/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NIKHTLQKELFLASGERLLSVVTV----------VKKKDKK-PCYLCV-VTTAPPVPVVTLCLIK 61
            ||:..:.:|:|:...|:||..:.|          :|.::|| ..:||: ||.:.|..|    .|.
Zfish     2 NIQSAISREIFVPRDEKLLVSIEVRRRMKRTGLSLKGRNKKYLTFLCLSVTNSRPAKV----FIT 62

  Fly    62 QSEQREG--EYKRKRSWQLDEIKWVDGRNEQFETHEFDLQLEKLY-KWYALNPHER--------- 114
            :.::.:|  :|.::..|.:::::.|:|.|...:|.||||..::.. :|.|.:..|:         
Zfish    63 KVKKFQGARQYAKRSQWSVEQLRQVNGINPDKDTPEFDLVFDRTTDQWEASSAAEKCMFVQVLYH 127

  Fly   115 --QNFL-AVLNRQIQKSVRGQRAEFRNVPAAWLSEKSPE-------------------------- 150
              |||. |.|:::...|..||:     .|.|..|:|||.                          
Zfish   128 ACQNFWEAKLSQEKPTSPGGQK-----TPGAVESKKSPAATNQTNFINCQPKLMGDACSVNMVIY 187

  Fly   151 --KVALGRAVQKTQHMDDEEDEEEEAQEFTALTDKEAN-------ELGKLFSECDFAIKD-AEQF 205
              |:.|.|  .||....:::..:.||...::.:..:::       ::|.:.......:.: .|:.
Zfish   188 RCKIFLNR--MKTSMTANQDRRQREAAGKSSRSRSKSSPSPPAVRKMGNVMRRASQVLSERGERL 250

  Fly   206 IEQLSRELHDLDGANMQSVLASEQKVLKMM 235
            ::...:..|.|.||. ....|:::..||.:
Zfish   251 MKADDKTSHMLHGAR-HFAEAAQRLALKQI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec3NP_648976.2 PH-EXOC1 9..126 CDD:270202 37/143 (26%)
Sec3_C 200..866 CDD:286804 8/37 (22%)
stxbp6lXP_005160460.1 PH-STXBP6 2..130 CDD:270200 32/131 (24%)
SNARE 228..277 CDD:328933 7/49 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D201698at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.