DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and SLC6A8

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_005620.1 Gene:SLC6A8 / 6535 HGNCID:11055 Length:635 Species:Homo sapiens


Alignment Length:553 Identity:119/553 - (21%)
Similarity:199/553 - (35%) Gaps:174/553 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 LVLCLCLNLSYANVVRFPRELDRY------GSAYLVPYVVLLFLVGLPMVLLEISVGQFLGQGAA 280
            ::.|:...:...||.|||     |      |..:|:|||::..:.|:|:..||||:|||:..|:.
Human    62 IMSCVGFAVGLGNVWRFP-----YLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSI 121

  Fly   281 HTWRASPIFKGACMISRFASWLSAIWVSLQAVLALA----YIGMFASNDLP-------------- 327
            :.|...|:|||.    .:||.:...:.:...::.||    |:....:..||              
Human   122 NVWNICPLFKGL----GYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCV 182

  Fly   328 --FR--ECAGPVKLRLSGYLLTGTSGQECLQL----TFLTPFWRNP---LYFGLLAAG------- 374
              ||  :||......|:           |.||    :.:..||.|.   |..||...|       
Human   183 EIFRHEDCANASLANLT-----------CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVT 236

  Fly   375 --LIGLWIVVMLCT-----HNAKILRRS------IFVFGLV-GLVLLCTLTGWEVRNSFSRHYFP 425
              |:..|::|..|.     ...||:..:      :.|..|| |::|...|.|       ..:|..
Human   237 LCLLACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDG-------IIYYLK 294

  Fly   426 ELWGFDSNLLAESNIWFNALMQVLFSVNCGFGALPMITGKFLYKGDAVRTSVVYLCFNLLINAIA 490
            ..|    :.|....:|.:|..|:.||...|.|||..:.....:..:..:.:::....|      :
Human   295 PDW----SKLGSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALIN------S 349

  Fly   491 VTLFMVQFDL-SSNGFQNMEELKPLTAI-----------YDRVLNGSREGDSHLLQHLVP---SL 540
            .|.|...|.: |..||...|:...::.:           |.|.:.         |..:.|   :|
Human   350 GTSFFAGFVVFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVT---------LMPVAPLWAAL 405

  Fly   541 IYALIILSAMVSITVAVYTSTRLVPRRPNYVICLIGLVVAVISFAAPKFL-------IARVLDSR 598
            .:.:::|..:.|..|.|          ..::..|:.|:.|...|...:.:       :..|:|..
Human   406 FFFMLLLLGLDSQFVGV----------EGFITGLLDLLPASYYFRFQREISVALCCALCFVIDLS 460

  Fly   599 LV-----------------GTMVVTALVFELIAITWIYGAKNIYTDLEFSIG-RPIFRVWM-WLW 644
            :|                 ||.::....:|.:.:.|:|||.....|:...|| ||.  .|| |.|
Human   461 MVTDGGMYVFQLFDYYSASGTTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPC--PWMKWCW 523

  Fly   645 -VICPAILTGILV------------------WW 658
             ...|.:..||.:                  ||
Human   524 SFFTPLVCMGIFIFNVVYYEPLVYNNTYVYPWW 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356 119/553 (22%)
SLC6A8NP_005620.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
SLC6sbd_CT1 52..621 CDD:271397 119/553 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.