DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and slc6a6b

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_001032750.1 Gene:slc6a6b / 569098 ZFINID:ZDB-GENE-030131-3077 Length:625 Species:Danio rerio


Alignment Length:560 Identity:127/560 - (22%)
Similarity:214/560 - (38%) Gaps:156/560 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 NVVRFPRELDRY------GSAYLVPYVVLLFLVGLPMVLLEISVGQFLGQGAAHTW-RASPIFKG 291
            ||.|||     |      |.|:|:||.:.||..|||:..||:::|||..:|....| :..|||.|
Zfish    63 NVWRFP-----YLCYKNGGGAFLIPYFIFLFGGGLPVFFLEVALGQFTSEGGITCWEKLCPIFTG 122

  Fly   292 ACMISRFASWLSAIWVSLQ-----AVLA--LAYIGMFASNDLPFRECAGPVKLRLSGYLLTGTSG 349
                   ..:.|.:.|||.     .:||  |.|:......:||:..|...            .:.
Zfish   123 -------IGYASIVIVSLLNIYYIVILAWGLYYLFQCFQPELPWASCNNK------------WNT 168

  Fly   350 QECLQLTF------------------LTPFW-RNPLYF--GL---------LAAGLIGLWIVVML 384
            :.|::.|.                  :|.|| ||.|..  |:         ||..|:.:|::...
Zfish   169 ENCVEDTLRRNKTLWAAANATNFTSPVTEFWERNVLSISDGIEEVGHVKWDLALCLLAMWVICFF 233

  Fly   385 CT-HNAKILRRSIFV---FGLVGLVLL----CTLTGWEVRNSFSRHYFPELWGFDSNLLAESNIW 441
            |. ...|...:.::|   |..|.|::|    .||.|  .......:.:|.:     ..|.:..:|
Zfish   234 CVWKGVKSTGKVVYVTATFPFVMLIVLLVRGVTLPG--AAEGIKFYLYPNV-----TRLGDPEVW 291

  Fly   442 FNALMQVLFSVNCGFGALPMITGKFLYKGDAVRTSVVYLCFN--LLINAI-AVTLFMVQFDL-SS 502
            .:|..|:.||.....||:..:.....||         |.|:.  ||:..: :.|.|:..|.: |.
Zfish   292 IDAGTQIFFSYAICLGAMTSLGSYNKYK---------YNCYRDCLLLGGLNSATSFVSGFAIFSV 347

  Fly   503 NGFQNMEELKPLTAI-----------YDRVLNGSREGDSHLLQHLVP------SLIYALIILSAM 550
            .||...|:...:..:           |.:.:.            ::|      .|.:.:::|..:
Zfish   348 LGFMAQEQGVDIADVAESGPGLAFIAYPKAVT------------MMPLPTFWAILFFIMLLLLGL 400

  Fly   551 VSITVAVYTS-TRLVPRRPNY------------VICLIGLVVAVISFAAPKFLIARVLDSRLV-G 601
            .|..|.|... |.||...|::            ::|.:..::.:.........:.::.|.... |
Zfish   401 DSQFVEVEGQITSLVDLYPSFLRKGYRREIFIAIVCFVSYLLGLTMVTEGGMYVFQLFDYYAASG 465

  Fly   602 TMVVTALVFELIAITWIYGAKNIYTDLEFSIG-RPIFRVWM-WLW-VICPAILTGILVWWCAD-- 661
            ..::....||.||:.|:|||.|.|..:|..|| ||  ..|| |.| |:.|.:..|..::....  
Zfish   466 VCLLWVAFFECIAVAWVYGADNFYDAIEEMIGYRP--NPWMKWSWTVVTPFLCVGCFIFSLVKYA 528

  Fly   662 DDQYDLLAEYLPRWA---------PILFVLAVIVIIACVQ 692
            ..:|:.:.|| |.|:         ..:..:.::|:|..:|
Zfish   529 PLRYNKIYEY-PDWSIGVGWTLALASMICIPMVVVIKIIQ 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356 119/514 (23%)
slc6a6bNP_001032750.1 SLC6sbd_TauT 41..582 CDD:271398 127/560 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.