DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and si:ch211-132b12.6

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_001038523.1 Gene:si:ch211-132b12.6 / 564583 ZFINID:ZDB-GENE-050420-179 Length:577 Species:Danio rerio


Alignment Length:532 Identity:126/532 - (23%)
Similarity:202/532 - (37%) Gaps:124/532 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 NVVRFPRELDRY-GSAYLVPYVVLLFLVGLPMVLLEISVGQFLGQGAAHTW-RASPIFKGACMIS 296
            ||.|||....|. |..:|:||:|.:...|||:.|||.::|||..:|....| |..|:.:|.....
Zfish    33 NVWRFPYLCYRNGGGVFLIPYLVFVVTCGLPLFLLETAMGQFTHEGGITCWHRLCPLAQGVGYAG 97

  Fly   297 RFASWLSAIWVSLQAVLALAYIGMFASNDLPFREC-------------AGPVKLRLSGYLLTGTS 348
            :.....|.::.::....||.|:....|:.||:..|             ||.:....: .|...||
Zfish    98 QLTVLYSCMYYTIILAWALFYLVSSFSSQLPWVSCNNIWNTDNCVNLAAGNLTFNRT-TLANSTS 161

  Fly   349 GQECLQLTFLTPFWRN---PLYFGLLAAG---------LIGLWIVVMLC-----THNAKILRRSI 396
            .        .|.||..   .|..|:...|         ||.:||:...|     ....|::..:.
Zfish   162 A--------ATEFWERRVLSLSGGIEDIGKINWEILLCLIAMWIICYFCIWKGVKSTGKVVYFTA 218

  Fly   397 ---FVFGLVGLVLLCTLTGWEVRNSFSRHYFPELWGFDSNLLAESNIWFNALMQVLFSVNCGFGA 458
               :|..||.|:...||.|  .......:.:||     ...||:..:|..|..||.||.:...|.
Zfish   219 TFPYVMLLVLLIRGLTLPG--ALQGVVFYLYPE-----PARLADPQVWMEAGTQVFFSYSVCSGI 276

  Fly   459 LPMITGKFLYKGDAVRTSVVYLCFNLLINAIAVTLFMVQFDL-SSNGFQNMEELKPLTAIYDRVL 522
            |..:.....|..:..|.| .:||   |:|  :.|.|:..|.: |..||....:..|:..:.:   
Zfish   277 LISLGSYNQYSNNCYRDS-FWLC---LLN--SGTSFVAGFAVFSVLGFMAHVQGVPVEEVAE--- 332

  Fly   523 NGSREGDSHL----------LQHLVPSLIYALIIL----SAMVSITVAVYTSTRLVP-------R 566
              |..|.:.:          ...|.....:.:|||    |..|.|...:.:...|.|       |
Zfish   333 --SGPGLAFIAYPQAMAMMPFPQLWAVCFFIMIILLGLDSQFVGIECVITSVMDLFPEVLRRAGR 395

  Fly   567 RPNYVI-----CLIGLVVAVISFAAPKFLIARVLDSRLV-GTMVVTALVFELIAITWIYGAKNIY 625
            |..:|:     |..|.::.|....   ..:.::.|:... |..::...|||.:||.|::||:.::
Zfish   396 RELFVLLLCLTCFFGQLIMVTEGG---MYVFQLFDNYACNGACLLFLSVFESLAIGWLFGAEKMF 457

  Fly   626 TDLE-FSIGRPIFRVWMWLWVICPAILTGILV------------------WWCADDDQYDL---- 667
            ..:| .:..||.:    | :::|...||.::.                  |:...|..|.|    
Zfish   458 DIIEDMTESRPNY----W-FMLCWKYLTPLVSLMSFVYSMVRYTPLTFNRWYVYPDWAYALGWLL 517

  Fly   668 -LAEYL--PRWA 676
             |:..|  |.||
Zfish   518 ALSSILLVPGWA 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356 118/506 (23%)
si:ch211-132b12.6NP_001038523.1 SLC6sbd-TauT-like 11..550 CDD:271387 126/532 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.