DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and myog

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_001016725.1 Gene:myog / 549479 XenbaseID:XB-GENE-490105 Length:235 Species:Xenopus tropicalis


Alignment Length:98 Identity:19/98 - (19%)
Similarity:39/98 - (39%) Gaps:26/98 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   797 GSMFGDSAIEEDISVDKFPGITQQQYVPFQ--------------------ASDTKQSRYSQRIRQ 841
            |.:...|.||:.:|  ..|.:|||::.|.|                    |:..::.|..:::.:
 Frog    47 GVLLQGSGIEDKVS--PHPTVTQQEHCPGQCLPWACKVCKRKTVSMDRRRAATLREKRRLKKVNE 109

  Fly   842 TAQPQTQTQMRPPRESVEK----HREVVYIRRL 870
            ..:...::.:..|.:.:.|    ...:.||.||
 Frog   110 AFEALKRSTLLNPNQRLPKVEILRSAIQYIERL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356
myogNP_001016725.1 BASIC 1..96 CDD:128794 11/50 (22%)
HLH 92..143 CDD:306515 8/51 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.