DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and cdc37

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_001015912.1 Gene:cdc37 / 548666 XenbaseID:XB-GENE-979269 Length:371 Species:Xenopus tropicalis


Alignment Length:167 Identity:32/167 - (19%)
Similarity:64/167 - (38%) Gaps:36/167 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   697 VEYNFFGMICEASKPAKEWGPADPLARHSWKQWRSVCQDTGRRDFTLRR----RGTRDYTHSIKK 757
            |:|:.:..| |.|....:..|....|  |..:||...:......|...:    :||.|....:.:
 Frog     2 VDYSVWDHI-EVSDDEDDTHPNIDTA--SLFRWRHQARVERMEQFDKEKEELSKGTSDCKKKLAE 63

  Fly   758 GQYSSATKYGVQNGGQT----------QTPMHQQHW----------KSSTPGN----SSPNYSGS 798
            .| ......|:::|||:          |....|:.|          :.:.|.|    |...:|.|
 Frog    64 CQ-KKLNDLGLKDGGQSDVQKLQSDLCQLKKEQKDWEKKENELRKKEKNMPWNVDTLSKEGFSKS 127

  Fly   799 MFGDSAIEEDISVDKFPGITQQQYVPFQASDTKQSRY 835
            :|...:..::::.::    .:|::..|...:.||.::
 Frog   128 VFNVKSENKEVTEEE----KEQKHKTFVEKNVKQLKH 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356
cdc37NP_001015912.1 CDC37_N 1..127 CDD:198139 26/128 (20%)
CDC37_M 130..274 CDD:215010 4/35 (11%)
CDC37_C 287..368 CDD:215009
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.