DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and AgaP_AGAP012626

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:XP_001230553.1 Gene:AgaP_AGAP012626 / 4397759 VectorBaseID:AGAP012626 Length:187 Species:Anopheles gambiae


Alignment Length:196 Identity:49/196 - (25%)
Similarity:71/196 - (36%) Gaps:45/196 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PQTTRSCISTVSSVVDSGGGRTTATSGRISSSGIVTLSDSNNTLSEIQGGYHDMDHDAVSKNFSI 187
            |.||.|          ||.|.:.:...:...|.....:...|..| ..|| |....|.||...::
Mosquito     5 PGTTNS----------SGSGGSGSRGAKKRDSWHTAAAPGTNGTS-TDGG-HGEPPDTVSDTAAL 57

  Fly   188 -------------SASAHNITT--------ASNAKLLPAVEDESNKQTKCSVFRGLVLCLCLNLS 231
                         |...|..||        .....|:.|:..|..::|.......|:..:...:.
Mosquito    58 AVKEAAPNGSSATSKPTHPATTETAQVLQSGKERSLVVALTGERRRETWSQKAEFLLAVIGFAVD 122

  Fly   232 YANVVRFPRELDRY------GSAYLVPYVVLLFLVGLPMVLLEISVGQFLGQGAAHTW-RASPIF 289
            ..||.|||     |      |.|:|:||.::|...|||:..:|:::|||...|....| |..|..
Mosquito   123 LGNVWRFP-----YICYQNGGGAFLIPYCIMLLFGGLPLFYMELALGQFHRCGCLSIWKRICPAL 182

  Fly   290 K 290
            |
Mosquito   183 K 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356 25/79 (32%)
AgaP_AGAP012626XP_001230553.1 SLC5-6-like_sbd 103..>185 CDD:294310 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.