DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and DAT

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_001261026.1 Gene:DAT / 36849 FlyBaseID:FBgn0034136 Length:644 Species:Drosophila melanogaster


Alignment Length:652 Identity:143/652 - (21%)
Similarity:243/652 - (37%) Gaps:219/652 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 HDMDHDAVSKNFSISASAHNITTASNAKLLPAVEDESNKQTKCSVFRGLVLCLCLNLSYANVVRF 238
            ||.|::::|                         ||  ::|.......|:..:...:..|||.||
  Fly    16 HDNDNNSIS-------------------------DE--RETWSGKVDFLLSVIGFAVDLANVWRF 53

  Fly   239 PRELDRY------GSAYLVPYVVLLFLVGLPMVLLEISVGQFLGQGAAHTW-RASPIFKGACMIS 296
            |     |      |.|:||||.::|.:.|:|:..:|:::||...:||...| |..|:|||.    
  Fly    54 P-----YLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGI---- 109

  Fly   297 RFASWLSAIWVSL--QAVLALAYIGMFAS--NDLPFREC-------------------------- 331
            .:|..|.|.:|..  ..::|.:....|||  |.||:..|                          
  Fly   110 GYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNY 174

  Fly   332 -----AGPVKLRLSGYLLTGTS---------------GQE------------------------- 351
                 .|...|..:...:.|:|               ..|                         
  Fly   175 SDLYAMGNQSLLYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDM 239

  Fly   352 --CLQLTFLTPFWRNPLYFGLLAAGLIGLWIVVMLCTHNAKILRRSIFVFGLVGLVLL--CTLTG 412
              ||.:.:|..::  .|:.|:..:|.: :|..             ::|.:.::.::|:  .||.|
  Fly   240 ALCLLIVYLICYF--SLWKGISTSGKV-VWFT-------------ALFPYAVLLILLIRGLTLPG 288

  Fly   413 ------WEVRNSFSRHYFPELWGFDSNLLAESNIWFNALMQVLFSVNCGFGALPMIT--GKF--- 466
                  :.:..:||..|             ::.:|.:|..||.||:..|||.|....  .|:   
  Fly   289 SFLGIQYYLTPNFSAIY-------------KAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNN 340

  Fly   467 LYKGDAVRTSVV---------YLCFNLLINAIAVTLFMVQFDLSSNGFQNMEELKP--LTAIYDR 520
            :|| ||:.||.:         ::.|::| ..:|.||.:...|:::.|        |  :..:|..
  Fly   341 VYK-DALLTSFINSATSFIAGFVIFSVL-GYMAHTLGVRIEDVATEG--------PGLVFVVYPA 395

  Fly   521 VLNGSREGDSHLLQHLVPSLIYALIILSAMVSI--------TVAVYTS-----TRLVPRRPNYVI 572
            .           :..:..|..:|||....::::        :.|:.|:     .::...|..:|.
  Fly   396 A-----------IATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELFVA 449

  Fly   573 CLIGL--VVAVISFAAPKFLIARVLDSRLVGTMVVTALVFELIAITWIYGAKNIYTDLEFSIGRP 635
            .|..|  ||.:.|.....|....:||....|..::.|:.||.||::||||......|:...||.|
  Fly   450 GLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFP 514

  Fly   636 IFRVWMWLW-VICPAILTGILVWWCADDDQYDLL--AEYL-PRWAPIL---FVLAVIVIIACVQI 693
            ..|.|...| .:.|..|..|.|:....   |:.|  |:|: |.||..|   ...:.:|:|..|.|
  Fly   515 PGRYWQVCWRFVAPIFLLFITVYGLIG---YEPLTYADYVYPSWANALGWCIAGSSVVMIPAVAI 576

  Fly   694 FR 695
            |:
  Fly   577 FK 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356 123/563 (22%)
DATNP_001261026.1 SLC6sbd_SERT-like_u1 27..597 CDD:271405 137/614 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.