DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and CG31904

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:97 Identity:24/97 - (24%)
Similarity:44/97 - (45%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 ELDRYG------SAYLVPYVVLLFLVGLPMVLLEISVGQFLGQGAAHTWRASPIFKGACMISRFA 299
            ||..:|      ..:::.|::.:....||:.|::..:|||...|....:|.:|||||........
  Fly   109 ELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLL 173

  Fly   300 SWLSAIWVSLQAVLALAYIGMFASNDLPFREC 331
            :..:..:.|:.||:.|.|........:|:..|
  Fly   174 NLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356 24/97 (25%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 21/83 (25%)
Cuticle_4 276..344 CDD:292577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.