Sequence 1: | NP_524125.2 | Gene: | blot / 39939 | FlyBaseID: | FBgn0027660 | Length: | 976 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723310.1 | Gene: | CG31904 / 319016 | FlyBaseID: | FBgn0260479 | Length: | 403 | Species: | Drosophila melanogaster |
Alignment Length: | 97 | Identity: | 24/97 - (24%) |
---|---|---|---|
Similarity: | 44/97 - (45%) | Gaps: | 6/97 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 241 ELDRYG------SAYLVPYVVLLFLVGLPMVLLEISVGQFLGQGAAHTWRASPIFKGACMISRFA 299
Fly 300 SWLSAIWVSLQAVLALAYIGMFASNDLPFREC 331 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
blot | NP_524125.2 | SLC5-6-like_sbd | 219..659 | CDD:271356 | 24/97 (25%) |
CG31904 | NP_723310.1 | SLC5-6-like_sbd | 123..>243 | CDD:294310 | 21/83 (25%) |
Cuticle_4 | 276..344 | CDD:292577 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0733 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR11616 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |