DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and AgaP_AGAP012290

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:XP_320247.4 Gene:AgaP_AGAP012290 / 1280400 VectorBaseID:AGAP012290 Length:190 Species:Anopheles gambiae


Alignment Length:81 Identity:24/81 - (29%)
Similarity:33/81 - (40%) Gaps:15/81 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QTTRSCISTVSSVVDSGGGRTTATSGRISSSGIVTLS-DSNNTLSEIQGGYHDMDHDAVSKNFSI 187
            ||.|:.:|:......:||    |..||.||...:|:| ||.:.          .|.|.....::.
Mosquito    40 QTRRAAVSSPLQRTRNGG----AAGGRDSSEPTITISMDSRSV----------RDADDAPPKYTP 90

  Fly   188 SASAHNITTASNAKLL 203
            ..|....|.|..||||
Mosquito    91 PPSYTTATGARIAKLL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356
AgaP_AGAP012290XP_320247.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.