powered by:
Protein Alignment blot and AgaP_AGAP000493
DIOPT Version :9
Sequence 1: | NP_524125.2 |
Gene: | blot / 39939 |
FlyBaseID: | FBgn0027660 |
Length: | 976 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_310600.4 |
Gene: | AgaP_AGAP000493 / 1271747 |
VectorBaseID: | AGAP000493 |
Length: | 109 |
Species: | Anopheles gambiae |
Alignment Length: | 58 |
Identity: | 13/58 - (22%) |
Similarity: | 22/58 - (37%) |
Gaps: | 20/58 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 393 RRSIFVFGLVGLVLLCTLTGWEVRNSFSRHYFP-ELWGFDSNLLAESNIWFNALMQVL 449
|:.:|:|.:| .:.| :..|:...|.|.:..||.||..:|
Mosquito 23 RQGVFIFNIV-------------------QWTPIKYLGYSYPLWAHAFGWFTALSSML 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0733 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.