DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and AgaP_AGAP000493

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:XP_310600.4 Gene:AgaP_AGAP000493 / 1271747 VectorBaseID:AGAP000493 Length:109 Species:Anopheles gambiae


Alignment Length:58 Identity:13/58 - (22%)
Similarity:22/58 - (37%) Gaps:20/58 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 RRSIFVFGLVGLVLLCTLTGWEVRNSFSRHYFP-ELWGFDSNLLAESNIWFNALMQVL 449
            |:.:|:|.:|                   .:.| :..|:...|.|.:..||.||..:|
Mosquito    23 RQGVFIFNIV-------------------QWTPIKYLGYSYPLWAHAFGWFTALSSML 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356 13/58 (22%)
AgaP_AGAP000493XP_310600.4 SLC5-6-like_sbd <25..88 CDD:294310 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.