DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment blot and Slc6a7

DIOPT Version :9

Sequence 1:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster
Sequence 2:NP_446448.2 Gene:Slc6a7 / 117100 RGDID:620928 Length:637 Species:Rattus norvegicus


Alignment Length:590 Identity:142/590 - (24%)
Similarity:248/590 - (42%) Gaps:147/590 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 LVLCLCLNLSYANVVRFP-RELDRYGSAYLVPYVVLLFLVGLPMVLLEISVGQFLGQGAAHTWRA 285
            |:.|:...:...||.||| |.....|.|:||||.::|.:.|:|:..||:|:|||...|....|:.
  Rat    47 LLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKI 111

  Fly   286 SPIFKGACMISRFASWLSAIWVSLQAVLALAYIGMFASNDLPFRECA------------------ 332
            ||:||||.........|.||:.::.....|.|:....:::||:..|.                  
  Rat   112 SPLFKGAGAAMLLIVGLVAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTERCLEHRGPKDGN 176

  Fly   333 GPVKLRLSGYLLTGTSGQECLQLTFLTPFW-RNPLYF----GL---------LAAGLIGLWIVVM 383
            |.:.|.||.   |.:..:|         :| |..|:.    |:         |...|:..|::|.
  Rat   177 GALPLNLSS---TVSPSEE---------YWSRYVLHIQGSQGIGRPGEIRWNLCLCLLLAWVIVF 229

  Fly   384 LC-----THNAKILRRSIFVFGLVGLVLL---CTLTG-WEVRNSFSRHYFPELWGFDSNLLAESN 439
            ||     ..:.|::..:.....|:.|:||   .||.| |:   ....:..|:.     :.|..|.
  Rat   230 LCILKGVKSSGKVVYFTATFPYLILLMLLVRGVTLPGAWK---GIQFYLTPQF-----HHLLSSK 286

  Fly   440 IWFNALMQVLFSVNCGFGALPMITGKFLYKGDAVRTSVVYLCFNLLINAIAVTLFMVQFDL-SSN 503
            :|..|.:|:.:|:..|||.|........:..:..|.:.:....|      |:|..:..|.: |..
  Rat   287 VWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGN------AITSILAGFAIFSVL 345

  Fly   504 GFQNMEELKPLT-----------AIYDRVLNGSREGDSHLLQHLVP--SLIYALIILS------- 548
            |:.:.|...|:.           .:|.:.:.         :..|.|  |.::..::|:       
  Rat   346 GYMSQELGVPVDQVAKAGPGLAFVVYPQAMT---------MLPLSPFWSFLFFFMLLTLGLDSQF 401

  Fly   549 AMVSITVAVYTST---RLVPRRPNY--VIC----LIGLVVAVISFAAPKFLIARVLD--SRLVGT 602
            |.:...|...|..   .|.|::..:  :||    |:||::.  :.....:|:  :||  |...|.
  Rat   402 AFLETIVTAVTDEFPYYLRPKKAVFSGLICVAMYLMGLILT--TDGGMYWLV--LLDDYSASFGL 462

  Fly   603 MVVTALVFELIAITWIYGAKNIYTDLEFSIG-RP--IFRVWMWLWVICPAILTGILVWWCADDDQ 664
            |||  ::...:|:|.:||.:....|:...:| :|  .||. .||: :.||.|..:||        
  Rat   463 MVV--VITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRA-CWLF-LSPATLLALLV-------- 515

  Fly   665 YDLL----AEY----LPRWAPILFVLAVIVIIAC--------VQIFRQVEYNFFGMICEASKPAK 713
            |.::    :||    .|.||.:|.:|  :.:::|        |.:.|: |.:.:..:.:||:||.
  Rat   516 YSIVKYQPSEYGSYRFPAWAELLGIL--MGLLSCLMIPAGMLVAVLRE-EGSLWERLQQASRPAI 577

  Fly   714 EWGPA 718
            :|||:
  Rat   578 DWGPS 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356 123/513 (24%)
Slc6a7NP_446448.2 SLC5-6-like_sbd 37..581 CDD:382020 140/587 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.