DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad74A and CDHR1

DIOPT Version :9

Sequence 1:NP_001246814.1 Gene:Cad74A / 39936 FlyBaseID:FBgn0036715 Length:1820 Species:Drosophila melanogaster
Sequence 2:XP_011538639.1 Gene:CDHR1 / 92211 HGNCID:14550 Length:917 Species:Homo sapiens


Alignment Length:771 Identity:253/771 - (32%)
Similarity:361/771 - (46%) Gaps:100/771 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLLLPLFLSLTAGQLVNQPPQFVPG-----TGDMSRFSLSENTPVGSPVFQLKGTDPEGGRLK 60
            :|.|.:.||..|...| .|..|.|...     .|:|:.|||.|:|||||.|:.|.||||||..:.
Human    63 VLCLGVRLFCVLFPAQ-ANFAPHFFDNGVGSTNGNMALFSLPEDTPVGSHVYTLNGTDPEGDPIS 126

  Fly    61 YSIS-----GPVFSVDRETGVVRLRQELDRETQDTVEVIISITDEGIYGTEPNTVSQRRVIPVRD 120
            |.||     ..|||||...|.:.|.:|||||.:|.:|.||||:| |:     |.|:::.||.|.|
Human   127 YHISFDPSTRSVFSVDPTFGNITLVEELDREREDEIEAIISISD-GL-----NLVAEKVVILVTD 185

  Fly   121 YNDNQPTFLGRPYTASVSESLPVGSELSVEPPIVVVDRDEGINSEVQMKCLEENDICDIFEVRAV 185
            .||..|.|:..||.|.|.|.:|.||.:.   .:..||||.|....|..      .:.::....||
Human   186 ANDEAPRFIQEPYVALVPEDIPAGSIIF---KVHAVDRDTGSGGSVTY------FLQNLHSPFAV 241

  Fly   186 KISDGNYTARVALKQQLDFESRPSYILTISASDS-----ALDNRLSSLATISINVIDIQDQPPIF 245
            ....|  ..|:.....||:|...::.:|:.|.|.     ..|...|:..|:::||.|:||..|:|
Human   242 DRHSG--VLRLQAGATLDYERSRTHYITVVAKDGGGRLHGADVVFSATTTVTVNVEDVQDMAPVF 304

  Fly   246 TNAPYSATVPENTPAGVSILTVKAVDGDVGIPREIFLSLEDEPFGHFELVPFGDPRDGTAVLQTT 310
            ...||...|.|:|..|..:|.|.|:|||.|.|..|..||.:...|.||:      .:.:..:..|
Human   305 VGTPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEI------NETSGAISIT 363

  Fly   311 SEP--LDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTF---SGP-- 368
            ..|  |.||         ||...::.||:.....||..:...|||.:.|:::|.|||   |||  
Human   364 QSPAQLQRE---------VYELHVQVTEMSPAGSPAAQATVPVTIRIVDLNNHPPTFYGESGPQN 419

  Fly   369 HFNVSITENLANGMPLPGLSIFVDDRDMGENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKV 433
            .|.:|:.|:...|..|.||.|.|:|.|.|.|:::.|.|   .....:|.|.|........|.:.|
Human   420 RFELSMNEHPPQGEILRGLKITVNDSDQGANAKFNLQL---VGPRGIFRVVPQTVLNEAQVTIIV 481

  Fly   434 LNASRLDYDVVDPDLRKFEFDLVA-SVKGVEK--AKTRVEIHLLDANDNAPVFDQGTYRFTAAEN 495
            .|::.:|::    ..:...|.|:| .|...||  :...|.|.|||.|||.|.||...|.....||
Human   482 ENSAAIDFE----KSKVLTFKLLAVEVNTPEKFSSTADVVIQLLDTNDNVPKFDSLYYVARIPEN 542

  Fly   496 LPVDAIIGHVKATDLDSGEFGHVRYVLKGFGADNFYVNPETGGVYLLKP---LDYEKQSSYSLTV 557
            .|..:.:..|.|.|.|:|.:|.|:|...|.|||.|.::|.||.:| .:|   ||.|..:.|:..|
Human   543 APGGSSVVAVTAVDPDTGPWGEVKYSTYGTGADLFLIHPSTGLIY-TQPWASLDAEATARYNFYV 606

  Fly   558 VAIDGGQREANANLFVGVTDVNDNHPNFESKEYSRTIREGAALFEPQFFVRAHDADGPSQGNGRV 622
            .|.|...:.:.|.:|:.:.||||:.|.|......:|:..|..:     .:.|.|.|. .:.|..|
Human   607 KAEDMEGKYSVAEVFITLLDVNDHPPQFGKSVQKKTMVLGTPV-----KIEAIDEDA-EEPNNLV 665

  Fly   623 KYSIVSENSIAGNVFRIEPDTGEIVIQKAARSMDTERG-------EYELVVSATDFGIPPLSNTT 680
            .|||.  ::...|||.|...||||.::.:.||:|....       .:.|.|.|.|.|.|..|.| 
Human   666 DYSIT--HAEPANVFDINSHTGEIWLKNSIRSLDALHNITPGRDCLWSLEVQAKDRGSPSFSTT- 727

  Fly   681 RVLVRVGISG----NQRPIFRGHFQNMENLPIIGPPSYRVSIPENAAAGSNVTSVS 732
             .|:::.|:.    ::.|:.....|..:|      |...|.:    .||:..|.|:
Human   728 -ALLKIDITDAETLSRSPMAAFLIQTKDN------PMKAVGV----LAGTMATVVA 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad74ANP_001246814.1 Cadherin_repeat 33..124 CDD:206637 47/95 (49%)
Cadherin_repeat 132..240 CDD:206637 30/112 (27%)
Cadherin_repeat 249..361 CDD:206637 35/113 (31%)
Cadherin_repeat 369..479 CDD:206637 34/112 (30%)
Cadherin_repeat 487..581 CDD:206637 34/96 (35%)
Cadherin_repeat 589..686 CDD:206637 30/103 (29%)
Cadherin_repeat 713..810 CDD:206637 5/20 (25%)
Cadherin_repeat 819..936 CDD:206637
Cadherin_repeat 953..1049 CDD:206637
Cadherin_repeat 1057..1166 CDD:206637
Cadherin_repeat 1175..1279 CDD:206637
Cadherin_repeat 1293..1390 CDD:206637
Cadherin_repeat 1402..1513 CDD:206637
Cadherin_repeat 1523..1628 CDD:206637
CDHR1XP_011538639.1 Cadherin_repeat 100..188 CDD:206637 46/93 (49%)
Cadherin_repeat 197..299 CDD:206637 30/112 (27%)
Cadherin_repeat 308..407 CDD:206637 35/113 (31%)
Cadherin_repeat 421..526 CDD:206637 34/111 (31%)
Cadherin_repeat 535..630 CDD:206637 34/95 (36%)
Cadherin_repeat 646..737 CDD:206637 30/100 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9485
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.