DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad74A and Cad99C

DIOPT Version :10

Sequence 1:NP_648973.1 Gene:Cad74A / 39936 FlyBaseID:FBgn0036715 Length:1820 Species:Drosophila melanogaster
Sequence 2:NP_733314.1 Gene:Cad99C / 43528 FlyBaseID:FBgn0039709 Length:1706 Species:Drosophila melanogaster


Alignment Length:345 Identity:66/345 - (19%)
Similarity:113/345 - (32%) Gaps:104/345 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 DAVSSE--ADTAASLQSDAEK-----NAQENVLILKNLLSDAAFTRLKESDTGLHHKSL------ 670
            |.||:|  |.....|..|..|     :....:.|||| .|.....||||...|...:|:      
  Fly    66 DTVSNEIVALKKVRLDQDIFKDGFPISGLREIQILKN-CSHENIVRLKEVVVGNSLESIFLVMEF 129

  Fly   671 --QELVDLAQNYYTEVAIPKLVADFGSLELSPVDGRTL--TDFMHTRGLRMRSLGYVVKLSDKLS 731
              |:|..|..|..|         .|...::..:..:.|  .|::|||        |::....|:|
  Fly   130 CEQDLASLLDNMET---------PFSESQVKCIIIQLLKGLDYLHTR--------YIIHRDLKVS 177

  Fly   732 HV---QSLCVH-----------------------------EMIVRALKHILQAVISAVATDTDKI 764
            ::   .:.|:.                             |::..|.|......:.|......::
  Fly   178 NLLLTDTGCLKIADFGLARYLNNANKPMTPGLVTLWYRPPELLFGAKKQTTAVDMWATGCILGEL 242

  Fly   765 AI------------KVAAALNMMLGIPENVAATPHNPWNVHPLIFRWLEKFLKKRYDYD------ 811
            .|            ::...:| :||.|   .||....::..||:    :.|..|...|:      
  Fly   243 LIHKPLLPGTSEISQIELIIN-LLGTP---TATIWPDFDSLPLV----QNFTLKEQPYNNLKSKF 299

  Fly   812 --LNAFSYKDLRKFAILRGLCHKVGIELIPRDFDMDSPAPFRKTDVVSLVPVH----KQAACSSA 870
              |:|..|..|....:....|.......:...:..:.|.|. .::::...|.|    |..:....
  Fly   300 PFLSASGYDLLNSLFMYNPACRATAERCLLSTYLREPPLPC-DSNLMPTFPHHRDMKKTTSAKQD 363

  Fly   871 DGRQL----LESSKTALDKG 886
            |.|:.    |.::|.:.|.|
  Fly   364 DPRKPRTSGLANNKPSFDVG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad74ANP_648973.1 Cadherin_repeat 33..124 CDD:206637
Cadherin_repeat 132..240 CDD:206637
Cadherin_repeat 249..361 CDD:206637
Cadherin_repeat 487..581 CDD:206637
Cadherin_repeat 589..686 CDD:206637 24/81 (30%)
Cadherin_repeat 713..810 CDD:206637 20/140 (14%)
Cadherin_repeat 819..936 CDD:206637 13/76 (17%)
Cadherin_repeat 953..1049 CDD:206637
Cadherin_repeat 1057..1166 CDD:206637
Cadherin_repeat 1175..1279 CDD:206637
Cadherin_repeat 1293..1390 CDD:206637
Cadherin_repeat 1402..1513 CDD:206637
Cadherin_repeat 1523..1628 CDD:206637
Cad99CNP_733314.1 CA_like 68..140 CDD:481204 21/72 (29%)
Cadherin_repeat 146..259 CDD:206637 14/120 (12%)
Cadherin_repeat 280..383 CDD:206637 20/107 (19%)
Cadherin_repeat 393..496 CDD:206637
Cadherin_repeat 518..594 CDD:206637
Cadherin_repeat 608..699 CDD:206637
Cadherin_repeat 710..802 CDD:206637
Cadherin_repeat 814..903 CDD:206637
Cadherin_repeat 915..1005 CDD:206637
Cadherin_repeat 1041..1144 CDD:206637
Cadherin_repeat 1159..1264 CDD:206637
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.