DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Olig3

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_443734.2 Gene:Olig3 / 94222 MGIID:2149955 Length:273 Species:Mus musculus


Alignment Length:222 Identity:60/222 - (27%)
Similarity:84/222 - (37%) Gaps:70/222 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 RMKANDRERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFALEQVLESGGSINL 218
            |:|.|.|||.|||:||.|::.||..:|..  |...||:||..|..|.|||..|...||       
Mouse    86 RLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSSLE------- 143

  Fly   219 DLEKLQNFTLSGERIT-----------KELFDALFVNPQPYPLFGRMFPYGQGMAPLA------- 265
            ::::|......|....           .....|..|:| .:|:.|.....|...:||:       
Mouse   144 EMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVHP-VHPILGGALSSGNASSPLSATSLPTI 207

  Fly   266 -----QHQ--TAPASHAEQPPAM---GGFQH--GMDYP----QQPPGFDFTGSMRFYHQQQQQPH 314
                 .|.  .||::    |||:   .||||  |:..|    |.||                   
Mouse   208 GTIRPPHSLLKAPST----PPALQLGSGFQHWAGLPCPCTICQMPP------------------- 249

  Fly   315 QPHHLQPNPQQESSPQQFSQEKYDLFR 341
             |.||  :....::..:.|.|..||.:
Mouse   250 -PPHL--SALSTANMARLSAESKDLLK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/52 (48%)
Olig3NP_443734.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72
HLH 86..139 CDD:306515 25/52 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.