DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and neurod6

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001072273.1 Gene:neurod6 / 779726 XenbaseID:XB-GENE-969227 Length:337 Species:Xenopus tropicalis


Alignment Length:289 Identity:79/289 - (27%)
Similarity:121/289 - (41%) Gaps:64/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KSPEDPNA-PRPK--RKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRV 179
            :..||.|. ||.:  ||..:.|.|:.|       :|:   ||::||.|||.|||.|||||:.||.
 Frog    65 REEEDENGLPRRRGPRKKKMTKVRIER-------IKV---RRVEANARERGRMHGLNDALDNLRK 119

  Fly   180 TLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELF-DALFV 243
            .:|...:..||:|||.||.|.|||:||.::|..|...:| |..:|:......:.|..|. ..|.:
 Frog   120 VVPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDL-LTFVQSLCKGLSQPTTNLVAGCLQL 183

  Fly   244 NPQPYPLFGRMFPYGQGMAPLAQHQTA-------PASHAEQ---PPAMGGFQHG-MDYPQQPPGF 297
            |.:.:    .|...|..|     |.|.       |..|:.:   ||:     || :|..:....:
 Frog   184 NARSF----LMSQSGDTM-----HHTRSPYTSVYPPYHSPELSTPPS-----HGTLDNSKTMKPY 234

  Fly   298 DFTGSMRFYHQQQQQPHQPHHLQPNPQQESSPQQFSQEKYDLFRGSF---DAAANLHSTNLDSGI 359
            .:..:...:::..    .|....|..:...||...:      :.|.|   ...|..:..|.:.|:
 Frog   235 SYCSAYESFYEST----SPECTSPQFEGPLSPPSMN------YNGIFSLKQEEALDYGKNYNYGM 289

  Fly   360 HQ----------QSSFYSQTPPWKDYPED 378
            |.          |||.: :.|....:|.|
 Frog   290 HYCAMAGRGPLGQSSMF-RLPTDSHFPYD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 30/51 (59%)
neurod6NP_001072273.1 bHLH_TS_NeuroD4_ATOH3 74..151 CDD:381564 39/86 (45%)
Neuro_bHLH 153..272 CDD:372170 25/143 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.