DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and olig4

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001039180.1 Gene:olig4 / 734024 XenbaseID:XB-GENE-484736 Length:209 Species:Xenopus tropicalis


Alignment Length:214 Identity:58/214 - (27%)
Similarity:84/214 - (39%) Gaps:40/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LNSRATNGVFD----PPLTSTPVKSPEDPNAPRPKR-KYAVGKNRVTRSRSPTQVVKIKRFRRMK 158
            |:||:::..||    |...|..:..........|.| :...||..:|:..        :...|:|
 Frog     6 LSSRSSSPEFDRGESPQFLSGAMFQAHSVGQRMPPRGRVKAGKRELTQEN--------QHELRLK 62

  Fly   159 ANDRERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLE 221
            .|.|||.|||:||.|::.||..:|..  |...||:||..|..|.|||..|...||       :::
 Frog    63 VNSRERQRMHDLNQAMDGLREVMPYSHGPSVRKLSKISTLILARNYIVMLSNSLE-------EMK 120

  Fly   222 KLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQGMAPLAQHQT---APASHAEQPPAMGG 283
            :|.|.....:|............||..|:...:        |.:.:.|   ..:|...||||...
 Frog   121 RLVNEVYGAQRAPGCASSLSTRVPQLPPVMPTV--------PASDYATYLSLSSSDICQPPATAP 177

  Fly   284 FQHGM-------DYPQQPP 295
            ...|:       .|..|||
 Frog   178 HFLGLPCPCHICQYLPQPP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/53 (47%)
olig4NP_001039180.1 bHLH_TS_OLIG2_like 59..121 CDD:381568 28/68 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.