DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and msgn1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001039104.1 Gene:msgn1 / 733924 XenbaseID:XB-GENE-972085 Length:172 Species:Xenopus tropicalis


Alignment Length:200 Identity:51/200 - (25%)
Similarity:78/200 - (39%) Gaps:51/200 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EDDDDASFDSGYEKS--FETEAQLSSRRRLDFGTPPTPAIPQPYSGGTWDAVPLSSPPAGFVGLL 81
            |||...|.||....|  ..|....::..|......|:|....|       ||...||        
 Frog    12 EDDYALSSDSEPNSSCMASTWDWKNNDERYSLSQTPSPQSLSP-------AVSYESP-------- 61

  Fly    82 DTSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSP---EDPNAPRPKRKYAVGKNRVTRSR 143
            .:||:|                |.|:.:.|.:.:.::.|   ...|....|:.:         ..
 Frog    62 YSSSSH----------------TQGLEEMPFSYSLLQYPSLCHGDNGDLTKKDH---------GH 101

  Fly   144 SPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETK--LTKIEILRFAHNYIFAL 206
            .|:..|:    ||.||::||:.||..:.:||..||..||.:..:.:  ||||:.|:...|||..|
 Frog   102 KPSMTVQ----RRRKASEREKLRMRAIAEALHTLRNNLPPMYSQGRQPLTKIQTLKCTINYISEL 162

  Fly   207 EQVLE 211
            ..:|:
 Frog   163 TNLLQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 22/53 (42%)
msgn1NP_001039104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 19/87 (22%)
bHLH_TS_Msgn1 102..167 CDD:381509 25/68 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.