DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and BHLHA9

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001157877.1 Gene:BHLHA9 / 727857 HGNCID:35126 Length:235 Species:Homo sapiens


Alignment Length:173 Identity:45/173 - (26%)
Similarity:62/173 - (35%) Gaps:46/173 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SPEDPNAPRPK---RKYAVGKNRVTRSRSPTQVVKIKR--------FRRMKANDRERNRMHNLND 172
            |.||...|.|:   ....:|.|..:.||...:....:|        .|||.||.|||.|:.:.|:
Human    19 SAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARPVRSKARRMAANVRERKRILDYNE 83

  Fly   173 ALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKEL 237
            |...||..|.......:|:||..||.|.:.|.||..||.:                         
Human    84 AFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRA------------------------- 123

  Fly   238 FDALFVNPQPYPLFGRMFPYGQGMAPLAQHQTAPASHAEQPPA 280
                  :|.|....|.:..:|    |.|:..|.....:..|||
Human   124 ------SPAPRGPCGHLECHG----PAARGDTGDTGASPPPPA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 22/51 (43%)
BHLHA9NP_001157877.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 12/49 (24%)
HLH 66..117 CDD:278439 21/50 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..235 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.