DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Atoh8

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_722473.1 Gene:Atoh8 / 71093 MGIID:1918343 Length:322 Species:Mus musculus


Alignment Length:241 Identity:62/241 - (25%)
Similarity:93/241 - (38%) Gaps:76/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QLSSRRRLDFG---------TPPTPAIPQPYSGGTWDA-----------VPLSSPPAGFVGLLDT 83
            ::|..|:..|.         |||.|...|..:.|..:|           :.|.:|||        
Mouse   105 EVSDARKRGFALGTVGPGLPTPPPPPASQSLAPGDPEAHSFREQALRPRILLCAPPA-------- 161

  Fly    84 SSNHSTRSGRTLVEHLNSRATNGV-FDPPLTSTPVKSPEDPNAP-RPKR------KYAVGKNRVT 140
                              |.|... ..||  :.|.:||..|..| ||..      .:.:..|...
Mouse   162 ------------------RPTQSAPLAPP--AAPQESPVRPAPPTRPGESSYSSISHVIYNNHPD 206

  Fly   141 RSRSP-----------TQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIE 194
            .|.||           |::..:::.||:.||.|||.|:|.::.|.|.||..:|......||:|:.
Mouse   207 SSASPRKRPGEATAASTEIKALQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLA 271

  Fly   195 ILRFAHNYIFALEQVLE---SGGSINLDLEKLQNFTLSGERITKEL 237
            |||.|.|||.:|.::.:   |....||      :|:...:|.|:.|
Mouse   272 ILRIACNYILSLARLADLDYSADHSNL------SFSECVQRCTRTL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 24/51 (47%)
Atoh8NP_722473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..96
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..144 10/38 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..221 18/89 (20%)
Basic motif, degenerate. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 231..244 7/12 (58%)
HLH 232..283 CDD:278439 24/50 (48%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 245..283 16/37 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.