DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and SCX

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001073983.1 Gene:SCX / 642658 HGNCID:32322 Length:201 Species:Homo sapiens


Alignment Length:71 Identity:30/71 - (42%)
Similarity:40/71 - (56%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 RSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALE 207
            |.|.|        |..||.|||:|.:::|.|...||..:|:.|.:.||:|||.||.|.:||..|.
Human    72 REPRQ--------RHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHLG 128

  Fly   208 QVLESG 213
            .||.:|
Human   129 NVLLAG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 23/51 (45%)
SCXNP_001073983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 10/27 (37%)
bHLH_TS_scleraxis 73..140 CDD:381521 29/70 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..177
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.