DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and NEUROG2

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_076924.1 Gene:NEUROG2 / 63973 HGNCID:13805 Length:272 Species:Homo sapiens


Alignment Length:210 Identity:73/210 - (34%)
Similarity:99/210 - (47%) Gaps:52/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLT 191
            ||.|..||.:.    :::...|.:||:.||:|||:||||||||||.||:.||..||:.||:.|||
Human    89 RPSRARAVSRG----AKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLT 149

  Fly   192 KIEILRFAHNYIFALEQVL----ESGGSINLDLEKLQNFTLSGERITKELF-DALFVNP------ 245
            |||.||||||||:||.:.|    ..||              .|..:...|| :|:.::|      
Human   150 KIETLRFAHNYIWALTETLRLADHCGG--------------GGGGLPGALFSEAVLLSPGGASAA 200

  Fly   246 ------QPYPLFGRMFPYGQGMAP---LAQHQTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFTG 301
                  .|.|  ...:......||   ::.:.|:|.|....|.:..|  ..|||.|.||.     
Human   201 LSSSGDSPSP--ASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAG--SDMDYWQPPPP----- 256

  Fly   302 SMRFYHQQQQQPHQP 316
                 .:.:..||.|
Human   257 -----DKHRYAPHLP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 38/51 (75%)
NEUROG2NP_076924.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..69
bHLH_TS_NGN2_ATOH4 104..172 CDD:381560 43/67 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..264 15/80 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145402
Domainoid 1 1.000 81 1.000 Domainoid score I8498
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002069
OrthoInspector 1 1.000 - - otm42278
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.