DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Olig1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_068538.2 Gene:Olig1 / 60394 RGDID:621129 Length:261 Species:Rattus norvegicus


Alignment Length:263 Identity:67/263 - (25%)
Similarity:87/263 - (33%) Gaps:91/263 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SRRRLDFGTPPTPAIPQ-----PYSGGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNS 101
            |:.|:: ..|.|...||     ......::.|....||        .||:.||          :|
  Rat     6 SQARVN-AAPATMLRPQRPGDVQLGASLYELVGYRQPP--------ISSSSST----------SS 51

  Fly   102 RATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNR 166
            .:|..:...|....|.....:|..|.|:.    |..|........|    ::.|| |.|.|||.|
  Rat    52 SSTASLLPKPAREKPEAPLAEPRGPAPES----GGARADAKEEQQQ----QQLRR-KINSRERKR 107

  Fly   167 MHNLNDALEKLR-VTLP-------SLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKL 223
            |.:||.|::.|| |.||       ..|.. ||:||..|..|.|||..|      |.|:       
  Rat   108 MQDLNLAMDALREVILPYSAAHCQGAPGR-KLSKIATLLLARNYILLL------GSSL------- 158

  Fly   224 QNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQGMAPLAQH---------QTAPASHAEQPP 279
                       :||..||                |.|..|.|..         ..||.|....|.
  Rat   159 -----------QELRRAL----------------GDGAGPAAPRLLLAGLPLLAAAPGSVLLAPG 196

  Fly   280 AMG 282
            |:|
  Rat   197 AVG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 27/59 (46%)
Olig1NP_068538.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..105 21/90 (23%)
bHLH_TS_OLIG1 96..165 CDD:381512 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.