DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Twist2

DIOPT Version :10

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_067723.1 Gene:Twist2 / 59327 RGDID:621286 Length:160 Species:Rattus norvegicus


Alignment Length:96 Identity:38/96 - (39%)
Similarity:55/96 - (57%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KSPEDPNAPRPKRKYAVGKNRVTRSRSPT-QVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTL 181
            ||.|| .:|.|.::...|        ||: |..:..:.:|:.||.|||.|..:||:|...||..:
  Rat    38 KSSED-GSPTPGKRGKKG--------SPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKII 93

  Fly   182 PSLPEETKLTKIEILRFAHNYIFALEQVLES 212
            |:||.: ||:||:.|:.|..||..|.|||:|
  Rat    94 PTLPSD-KLSKIQTLKLAARYIDFLYQVLQS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 bHLH_TS_NGN 155..211 CDD:381434 26/55 (47%)
Twist2NP_067723.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 10/33 (30%)
bHLH_TS_TWIST2 51..132 CDD:381543 32/82 (39%)

Return to query results.
Submit another query.