DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and atoh7

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_571707.1 Gene:atoh7 / 58216 ZFINID:ZDB-GENE-000926-1 Length:134 Species:Danio rerio


Alignment Length:106 Identity:38/106 - (35%)
Similarity:54/106 - (50%) Gaps:9/106 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLT 191
            :|:|.........:.||.|.:.....| |||.||.|||.||..||.|.::||..:|...::.||:
Zfish     2 KPRRPSCADSGSDSDSRDPEKFESAMR-RRMAANARERKRMQGLNTAFDRLRKVVPQWGQDKKLS 65

  Fly   192 KIEILRFAHNYIFALEQVLESGGS--------INLDLEKLQ 224
            |.|.|:.|.:||.||.::|...|.        :||..:.||
Zfish    66 KYETLQMALSYIMALNRILSDAGRHVDPQKDWLNLQFDGLQ 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/51 (49%)
atoh7NP_571707.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 5/24 (21%)
HLH 29..80 CDD:278439 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.