DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and hand2

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_571701.3 Gene:hand2 / 58150 ZFINID:ZDB-GENE-000511-1 Length:205 Species:Danio rerio


Alignment Length:154 Identity:49/154 - (31%)
Similarity:69/154 - (44%) Gaps:26/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DPP-----LTSTPVKSPED-PNAPRPKRKYAVGKNRVTRSR------------SPTQVVKIKRFR 155
            :||     |.|.|..||.| ..||....:|:.|...:..|.            .| :.||    |
Zfish    29 EPPYFHGWLISHPEMSPPDYTMAPSYSPEYSTGAPGLDHSHYGGVPGAGAVGMGP-RTVK----R 88

  Fly   156 RMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVL---ESGGSIN 217
            |..||.:||.|..::|.|..:||..:|::|.:|||:||:.||.|.:||..|..:|   |..|...
Zfish    89 RPTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDILDKDEQNGETE 153

  Fly   218 LDLEKLQNFTLSGERITKELFDAL 241
            ....:.:......||..||:.|.|
Zfish   154 AFKAEFKKTDAKEERRKKEMNDVL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 23/51 (45%)
hand2NP_571701.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..103 10/31 (32%)
HLH 88..139 CDD:278439 23/50 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..194 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.