DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and olig3

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001103863.1 Gene:olig3 / 566728 ZFINID:ZDB-GENE-080903-1 Length:255 Species:Danio rerio


Alignment Length:271 Identity:66/271 - (24%)
Similarity:93/271 - (34%) Gaps:97/271 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GLLDT-SSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGKNRVTRS 142
            |||:: ||..:....:...||             |:.||..|           ||.: |.:||..
Zfish    31 GLLNSVSSTQNELLQKMASEH-------------LSKTPSGS-----------KYKL-KKQVTEQ 70

  Fly   143 RSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFA 205
                   :|::. |:|.|.|||.|||:||.|::.||..:|..  |...||:||..|..|.|||..
Zfish    71 -------EIQQL-RLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILM 127

  Fly   206 LEQVLES-----------------------GGSINLDLEKLQNFTLSGERITKELFDALFVNPQP 247
            |...|:.                       ||:.:.......:..|.|..::......|.:    
Zfish   128 LTSSLDEMKRLVGEIYGGHHSAFHCGTVSHGGAHSAGAAHQVHHPLLGSALSGSTSSTLSL---- 188

  Fly   248 YPLFGRMFPYGQGMAPLAQHQTAPASHAEQPPAMGG-FQH--GMDYP----QQPPGFDFTGSMRF 305
                       .|:..:....|...|....|..:|| |||  |:..|    |.||          
Zfish   189 -----------PGLTSIRAPHTLMKSTPTPPLQLGGSFQHWAGLPCPCTICQVPP---------- 232

  Fly   306 YHQQQQQPHQP 316
                  .||.|
Zfish   233 ------PPHLP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/53 (47%)
olig3NP_001103863.1 HLH 76..129 CDD:278439 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.