DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and MESP1

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_061140.1 Gene:MESP1 / 55897 HGNCID:29658 Length:268 Species:Homo sapiens


Alignment Length:274 Identity:81/274 - (29%)
Similarity:104/274 - (37%) Gaps:50/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 AVPLSSPPAGFVGLLDTSSNHSTR-------SGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPN 124
            |.|| .||.....:|..:...:.|       .||:||...:|..:.     |..| ||.||..|.
Human     2 AQPL-CPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGST-----PADS-PVASPARPG 59

  Fly   125 APRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPS--LPEE 187
            ..|..|..:||:.....||       :...:|..|::||:.||..|..||.:||..||.  .|..
Human    60 TLRDPRAPSVGRRGARSSR-------LGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAG 117

  Fly   188 TKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDA-------LFVNP 245
            ..|||||.||.|..||..|..||      .|..|.||       |..::..||       |..:.
Human   118 QSLTKIETLRLAIRYIGHLSAVL------GLSEESLQ-------RRCRQRGDAGSPRGCPLCPDD 169

  Fly   246 QPYPLFGRMFPYGQGMA---PLAQHQTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFTGSMRFYH 307
            .|..:..|....|||..   .|.....|.||.. .|||..|.:...: |:.||......:..  .
Human   170 CPAQMQTRTQAEGQGQGRGLGLVSAVRAGASWG-SPPACPGARAAPE-PRDPPALFAEAACP--E 230

  Fly   308 QQQQQPHQPHHLQP 321
            .|..:|..|..|.|
Human   231 GQAMEPSPPSPLLP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 24/53 (45%)
MESP1NP_061140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..93 23/88 (26%)
bHLH_TS_Mesp 83..147 CDD:381508 29/69 (42%)
CPLCP 163..167 1/3 (33%)
2 X 2 AA tandem repeats of G-Q 182..185 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.