DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and mespb

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001016653.1 Gene:mespb / 549407 XenbaseID:XB-GENE-970939 Length:292 Species:Xenopus tropicalis


Alignment Length:274 Identity:68/274 - (24%)
Similarity:99/274 - (36%) Gaps:65/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PLSSPPA-GFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAPRPKRKY 132
            |...|.: |:..|...||:.|:......:.::   |:..:|        |..|........:|: 
 Frog    24 PCGYPSSEGYSSLSPASSSDSSGQSPPYMPYI---ASQEIF--------VNIPAAYGQAACQRR- 76

  Fly   133 AVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPS--LPEETKLTKIEI 195
              |.......|......|:...:|..|::||:.||.||:.||:.||..||.  .|.:..|||||.
 Frog    77 --GLRHDADKRGKKNTGKLPYSQRQSASEREKLRMRNLSKALQNLRRYLPPSVAPLDKTLTKIET 139

  Fly   196 LRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQG 260
            |:...:||..|      ...:.|..|.|....|:..:.|                  .:.|.|..
 Frog   140 LQLTISYISHL------SAQLGLTEEILTQRRLAETQRT------------------NLCPSGFS 180

  Fly   261 --MAPLAQHQTAPASHAEQP---PAMGGFQHGMDYPQQPPGFDFTGSMRFYHQQ----QQQPHQP 316
              |.|..:..|.|......|   |.| .|.....||:  ||         ||.:    ||....|
 Frog   181 CCMDPTHRLCTTPEEDHFNPAATPTM-PFSEARCYPE--PG---------YHGREAVCQQSCETP 233

  Fly   317 HHLQPNPQQESSPQ 330
            ..|:   |:.:|||
 Frog   234 LQLK---QEITSPQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 23/53 (43%)
mespbNP_001016653.1 HLH 97..150 CDD:278439 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.