DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Atoh7

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_058560.1 Gene:Atoh7 / 53404 MGIID:1355553 Length:149 Species:Mus musculus


Alignment Length:148 Identity:47/148 - (31%)
Similarity:66/148 - (44%) Gaps:21/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 VKSPEDPNAP----RPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKL 177
            :||...|:.|    |.....|....|......|.::....| ||:.||.|||.||..||.|.::|
Mouse     1 MKSACKPHGPPAGARGAPPCAGAAERAVSCAGPGRLESAAR-RRLAANARERRRMQGLNTAFDRL 64

  Fly   178 RVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGS--INLDLEKLQN----FTLSGERITKE 236
            |..:|...::.||:|.|.|:.|.:||.||.::|.....  :.|..|:...    ....|.|    
Mouse    65 RRVVPQWGQDKKLSKYETLQMALSYIIALTRILAEAERDWVGLRCEQRGRDHPYLPFPGAR---- 125

  Fly   237 LFDALFVNPQPY--PLFG 252
                |.|:|:||  .|||
Mouse   126 ----LQVDPEPYGQRLFG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 24/51 (47%)
Atoh7NP_058560.1 HLH 54..99 CDD:197674 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.