DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Olig2

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_058663.2 Gene:Olig2 / 50913 MGIID:1355331 Length:323 Species:Mus musculus


Alignment Length:396 Identity:88/396 - (22%)
Similarity:124/396 - (31%) Gaps:132/396 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ETEAQLSSRRRLDFGTPPTPAIPQP----------------YSGGT-WDAVPLSSPPAGFVGLLD 82
            :::|.|.|.|         |:.|:|                ::||| ..:.|...||       :
Mouse     2 DSDASLVSSR---------PSSPEPDDLFLPARSKGGSSSGFTGGTVSSSTPSDCPP-------E 50

  Fly    83 TSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQ 147
            .||......|.: ..|...:...|.|....:||...:.....:...|.|         :..:..:
Mouse    51 LSSELRGAMGAS-GAHPGDKLGGGGFKSSSSSTSSSTSSAATSSTKKDK---------KQMTEPE 105

  Fly   148 VVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSL--PEETKLTKIEILRFAHNYIFALEQVL 210
            :.::    |:|.|.|||.|||:||.|::.||..:|..  |...||:||..|..|.|||..|...|
Mouse   106 LQQL----RLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSL 166

  Fly   211 ESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGRMFPYGQGMAPLAQHQTAPASHA 275
            |                 ..:|:..|::........|....|...   ....|.|....|.|:||
Mouse   167 E-----------------EMKRLVSEIYGGHHAGFHPSACGGLAH---SAPLPTATAHPAAAAHA 211

  Fly   276 EQPPAMGGFQHGMDYPQQPP----------------------GFDFTGSMRFYHQQQQQPHQPHH 318
            ...||       :.:|..||                      |....||:|          .||.
Mouse   212 AHHPA-------VHHPILPPAAAAAAAAAAAAAVSSASLPGSGLSSVGSIR----------PPHG 259

  Fly   319 LQPNPQQESSPQQFSQEKYDLFRGSFDAAANLHSTNLDSGIHQQSSFYSQTPPWKDYPEDQAHVH 383
            |..:|                   |..|||.|......||.......:...|    .|.....| 
Mouse   260 LLKSP-------------------SAAAAAPLGGGGGGSGGSGGFQHWGGMP----CPCSMCQV- 300

  Fly   384 PVPHQH 389
            |.||.|
Mouse   301 PPPHHH 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 25/53 (47%)
Olig2NP_058663.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107 23/130 (18%)
bHLH_TS_OLIG2 95..179 CDD:381510 32/113 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835494
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.