DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and NEUROG3

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_066279.2 Gene:NEUROG3 / 50674 HGNCID:13806 Length:214 Species:Homo sapiens


Alignment Length:192 Identity:67/192 - (34%)
Similarity:89/192 - (46%) Gaps:51/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 PVKSPEDP----------------NAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRER 164
            |..:|..|                .|||..|....|:   :|.:|...:.|.:|.||.|||||||
Human    32 PTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGR---SRPKSELALSKQRRSRRKKANDRER 93

  Fly   165 NRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLS 229
            |||||||.||:.||..||:.|::.||||||.||||||||:||.|.|                   
Human    94 NRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTL------------------- 139

  Fly   230 GERITKELFDALFVNPQPYPLFGRM-------FPYGQGMAPLAQ-HQTAPASHAEQPPAMGG 283
              ||...   :|:....|.|..|.:       ..:|...:|::| ...:||:..|:.|.:.|
Human   140 --RIADH---SLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAGSLSPAASLEERPGLLG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 38/51 (75%)
NEUROG3NP_066279.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98 24/68 (35%)
HLH 81..140 CDD:238036 42/79 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145436
Domainoid 1 1.000 81 1.000 Domainoid score I8498
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002069
OrthoInspector 1 1.000 - - otm42278
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4181
SonicParanoid 1 1.000 - - X1366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.