DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Neurod6

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001102707.1 Gene:Neurod6 / 500137 RGDID:1562793 Length:337 Species:Rattus norvegicus


Alignment Length:268 Identity:81/268 - (30%)
Similarity:117/268 - (43%) Gaps:50/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLP 182
            :..||.|. .|:|: .:.|.:.|:.|    :.::| |||.:||.|||||||.|||||:.||..:|
  Rat    65 REEEDENG-LPRRR-GLRKKKTTKLR----LERVK-FRRQEANARERNRMHGLNDALDNLRKVVP 122

  Fly   183 SLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQP 247
            ...:..||:|||.||.|.|||:||.::|..|...:| |..:||......:.|..|.....     
  Rat   123 CYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDL-LTFVQNLCKGLSQPTTNLVAGCL----- 181

  Fly   248 YPLFGRMFPYGQGMAPLAQHQTAPAS------HAEQ---PPAMGGFQHG-MDYPQQPPGFDFTGS 302
             .|..|.|..||| ...|.|..:|.|      |:.:   ||.     || :|..:....:::..:
  Rat   182 -QLNARSFLMGQG-GEAAHHTRSPYSTFYPPYHSPELATPPG-----HGTLDNSKSMKPYNYCSA 239

  Fly   303 MR-FYHQQQQQPHQPHH---LQPNPQQESSPQQFSQEKYDLFRGSFDAAANLHSTNLDSGIHQQS 363
            .. ||.....:...|..   |.|.|...:......||:      :.|     :..|.:.|:|   
  Rat   240 YESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEE------TLD-----YGKNYNYGMH--- 290

  Fly   364 SFYSQTPP 371
              |...||
  Rat   291 --YCAVPP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 31/51 (61%)
Neurod6NP_001102707.1 HLH 100..151 CDD:197674 29/50 (58%)
Neuro_bHLH 153..272 CDD:315246 29/131 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.