DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tap and Bhlhe23

DIOPT Version :9

Sequence 1:NP_524124.1 Gene:tap / 39935 FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001102681.1 Gene:Bhlhe23 / 499952 RGDID:1559760 Length:223 Species:Rattus norvegicus


Alignment Length:205 Identity:58/205 - (28%)
Similarity:79/205 - (38%) Gaps:55/205 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAP 126
            ||...|.|.|..||..|   ::|...|                              ..||....
  Rat    44 GGDLPAAPASRVPAATV---ESSGEQS------------------------------GDEDEAFE 75

  Fly   127 RPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLP--SLPEETK 189
            |.:|:...|. .|...|.|.:    :|..|:..|.|||.|||:|||||:.||..:|  ..|...|
  Rat    76 RRRRRRGPGV-AVDARRRPRE----QRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRK 135

  Fly   190 LTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGR- 253
            |:||..|..|.|||....|.||       ::.:|..:...|:.:      |..|...|...||: 
  Rat   136 LSKIATLLLAKNYILMQAQALE-------EMRRLVAYLNQGQSL------AAPVAAAPLTPFGQA 187

  Fly   254 -MFPYGQGMA 262
             ::|:..|.|
  Rat   188 AVYPFTAGAA 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 26/53 (49%)
Bhlhe23NP_001102681.1 bHLH_TS_bHLHe22_bHLHb5 99..168 CDD:381524 30/75 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339126
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.